SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000033083 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000033083
Domain Number 1 Region: 117-213
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-27
Family PDZ domain 0.0000958
Further Details:      
 
Domain Number 2 Region: 8-71
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-21
Family PDZ domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000033083   Gene: ENSRNOG00000022060   Transcript: ENSRNOT00000037848
Sequence length 264
Comment pep:known chromosome:RGSC3.4:4:127959466:127987534:-1 gene:ENSRNOG00000022060 transcript:ENSRNOT00000037848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKAGNACVAMPHKIGRIIEGSPADRCGKLKVGDRILAVNGCSITNKSHSDIVNLIKEAGN
TVTLRIIPGDESSNATLLTNAEKIATITTTHAPSQQGTQETRTTTKPKPDSQFEFKGPQA
TQEQDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGPAERCGKMRIGDEILEING
ETTKNMKHSRAIELIKNGGRRVRLFLRRGDGSVPEYAMIPPNIAACMRNEKFGEACFYLM
GHNQTTTPAATGTAPPPVHKVFRK
Download sequence
Identical sequences 10116.ENSRNOP00000033083 ENSRNOP00000033083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]