SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000033439 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000033439
Domain Number 1 Region: 20-73,191-392
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.62e-48
Family Inositol polyphosphate kinase (IPK) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000033439   Gene: ENSRNOG00000025883   Transcript: ENSRNOT00000035977
Sequence length 394
Comment pep:known chromosome:RGSC3.4:20:5379966:5391529:-1 gene:ENSRNOG00000025883 transcript:ENSRNOT00000035977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVRHGSDKGKAGVGVPLEPFLHQVGGHLSVLRYDAYTVCKPLIFQEQKFYESLPLAMRR
FTPQYKGTITVHLRRDSRGHLGLVANPLKENLEPFQVSPESRAVALWQTLQQTTSSEGSP
CPLAQMAHSLKESAAKALLRSDCHLSTQASPLVESAVGSQIERKGFNPWGLHCHQAHLSR
LCSQYPEDKRHRILTTPNSQAQGKEICILDLSISGEQNGDDLSEPKTARSTKDCTQRFDL
ARQALCQPKVYQTDKKSFLCKDKYYGRKLSVEGFRQALSQFLHDGIRLRTELLEPILRRL
QALLTVIRSQSSYRFYSSSLLIIYDGEPPQTTQGSTSGSTSGDPAKVDVRMIDFAHTTYK
GSWNERTTYEGPDPGYIFGLENLIGILRDIQEGE
Download sequence
Identical sequences ENSRNOP00000033439 10116.ENSRNOP00000033439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]