SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000033441 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000033441
Domain Number 1 Region: 196-490
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.23e-95
Family Cryptochrome/photolyase FAD-binding domain 0.0000159
Further Details:      
 
Domain Number 2 Region: 5-214
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 5.1e-54
Family Cryptochrome/photolyase, N-terminal domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000033441   Gene: ENSRNOG00000006622   Transcript: ENSRNOT00000037233
Sequence length 607
Comment pep:known chromosome:RGSC3.4:7:20643879:20709215:1 gene:ENSRNOG00000006622 transcript:ENSRNOT00000037233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLE
DLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEA
GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCTT
PLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMN
ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA
TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA
VACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR
RTDPNGDYIRRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRL
NIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGLMGYAPGENVPSGGSGGGTGILAHXXG
LVXXHGSGGDCSQGSGILHYAHGDSQQTNPLKQGRSSMGTGLSSGKRPSQEEDAQSVGPK
VQRQSSN
Download sequence
Identical sequences ENSRNOP00000033441 10116.ENSRNOP00000033441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]