SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000034016 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000034016
Domain Number 1 Region: 557-677
Classification Level Classification E-value
Superfamily PX domain 2.49e-24
Family PX domain 0.0012
Further Details:      
 
Domain Number 2 Region: 372-518
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.65e-24
Family Regulator of G-protein signaling, RGS 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000034016
Domain Number - Region: 115-210
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit E 0.0144
Family Cytochrome c oxidase subunit E 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000034016   Gene: ENSRNOG00000004186   Transcript: ENSRNOT00000031060
Sequence length 958
Comment pep:known chromosome:RGSC3.4:6:53760849:53827207:1 gene:ENSRNOG00000004186 transcript:ENSRNOT00000031060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMLTKASLSIWGWGSLGIVLFLITFGPFVIFYLAFYILCFVGGGLVVTLLYGKTNSEKYL
EQCEHSFLPPTSPGVPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYW
YYTLSDDETFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRMVDDFGTHLRVFRKAQQRV
TEKDDQVKGTAEDLVETFFEVEVEMEKDVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPG
DFQSKIMRYFVREILARGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDN
IGELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQSGKEINT
VKLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQLEV
LSSRQRDGKQQTNQTKGLLRAAAVGIYEQYLSEKASPRVIVDDYLVAKLADTLNHEDPTP
EIFDDIQRKVYELMLRDERFYPSFRQNPLYVRMLAELDMLKDPSFRGSDDGDGESFNGSP
TGSINLSLDDLSSVTSDDSVQLHAYISDTGVCNDHGKTYALYAITVHRRSLNTEEMWKTY
RRYSDFHDFHMRITEQFENLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLTPEML
KASPALAHCVYDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGVT
KMSDNVGRMSERLGQDIKQSFFKVPPLITKTDSDPEHCRVSAQLDDNVDDNIPLRVMLLL
MDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQVADSVKRFRD
ALWPNGILAEAAPCRDKAIRMRTRIAGKTKLFAVMPDELKHIIGAETTRKGILRVFEMFQ
HNQLNRRMVYVFLEGFLETLFPQYKFRELFNKLHSRSKQMQKYKQKLQSTQAPSLQKR
Download sequence
Identical sequences 10116.ENSRNOP00000034016 ENSRNOP00000034016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]