SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000034120 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000034120
Domain Number 1 Region: 385-462
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000606
Family Regulator of G-protein signaling, RGS 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000034120   Gene: ENSRNOG00000025551   Transcript: ENSRNOT00000039378
Sequence length 496
Comment pep:known chromosome:RGSC3.4:7:71603675:71645430:-1 gene:ENSRNOG00000025551 transcript:ENSRNOT00000039378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSEPPEVTEEEFENYLATDNFLVDYFNEFLSLPTFSEAIRFNVDYGVFEVINDAPQLLE
KQLKKILQNQQPRNPIYDVVRKGKSDSKAKQKSVPCEDEAINVNYTIMCLKREQGINWIK
RKRLPAFLESDCYFEYRLAKLISQATWSSSGMNFTVGTNFSPWILRKPPTPPHASTEEDN
SGIMKTFYVSLGQASYTQTKDWFTLAKESEKTVTTFSLPCCLPHHESASSVVATVSEIFE
IFDDGIHPRTTNGLSKTSKIVSEPEEEEGSISMKDTPSQALLRIYLERKGEDRNLTVHFS
SFDEFLNAYIIFILREAIHHITGQSLSDTPGYVNYYKVAHVIFDKAKPVPSQKATVSPPV
EVVQETSEDRLEENVSLSSESESVGPESRADWCISHKTYDIGNRREFERFKKFLKGTLGE
RYWWLWMDIERLKVLKDPGRHQRHLEKMKKCYLVSSGERYLSAEILSKFKLMNGSWWTED
HLKNIQIEVLKPLLLY
Download sequence
Identical sequences ENSRNOP00000034120 10116.ENSRNOP00000034120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]