SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000034271 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000034271
Domain Number 1 Region: 10-180
Classification Level Classification E-value
Superfamily UBC-like 7.34e-54
Family UBC-related 0.0000000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000034271   Gene: ENSRNOG00000027514   Transcript: ENSRNOT00000031007
Sequence length 183
Comment pep:known chromosome:RGSC3.4:1:72885667:72889204:1 gene:ENSRNOG00000027514 transcript:ENSRNOT00000031007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNF
KLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWK
PVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFER
CLK
Download sequence
Identical sequences A0A024R4T4 A0A0D9S6F2 A0A1U7RG31 A0A250YBI6 A0A287BNE4 A0A2F0B976 A0A2K5CC13 A0A2K5JNT3 A0A2K5LBH6 A0A2K5RWM1 A0A2K5VQS3 A0A2K5YAS0 A0A2K6BGF5 A0A2K6GWV2 A0A2K6KDG1 A0A2K6NJ64 A3KN22 D3ZNQ6 F6Z6D4 F7CFP7 G1TC10 G3RC12 H0WSH0 H2P0H9 I3NDF0 K7BZJ3 P61081 P61082
ENSMUSP00000005714 ENSPPYP00000011779 ENSGGOP00000013030 10090.ENSMUSP00000005714 10116.ENSRNOP00000034271 9544.ENSMMUP00000029784 9600.ENSPPYP00000011779 9606.ENSP00000253023 9913.ENSBTAP00000016937 9986.ENSOCUP00000014290 ENSPPYP00000011779 ENSBTAP00000016937 ENSPVAP00000013184 ENSGGOP00000013030 ENSOGAP00000005031 ENSSTOP00000022397 ENSPVAP00000013184 NP_001076972.1.59421 NP_001076972.1.76553 NP_001101941.1.100692 NP_001101941.1.4139 NP_001181072.1.72884 NP_003960.1.87134 NP_003960.1.92137 NP_663553.1.92730 XP_002721946.1.1745 XP_003795384.1.62490 XP_004061666.1.27298 XP_004283298.1.21590 XP_004405738.1.74151 XP_004439191.1.5094 XP_004596965.1.84141 XP_004616978.1.94378 XP_004672945.1.11716 XP_004866579.1.39548 XP_005088008.1.91757 XP_005342463.1.77405 XP_005414457.1.28644 XP_005590683.1.63531 XP_006218740.1.17985 XP_006747841.1.47382 XP_006997256.1.50099 XP_007123172.1.24612 XP_007175449.1.59432 XP_007457550.1.90284 XP_007636746.1.28591 XP_007648298.1.69978 XP_007996657.1.81039 XP_008159313.1.99482 XP_008577184.1.73410 XP_008821014.1.79516 XP_010960335.1.22495 XP_010987514.1.51371 XP_011287828.1.62641 XP_011382939.1.92234 XP_011814522.1.43180 XP_011824456.1.47321 XP_012005899.1.54773 XP_012328578.1.9421 XP_012511341.1.63892 XP_012607860.1.48125 XP_013206931.1.66349 XP_015981243.1.101085 XP_016792509.1.37143 XP_017365144.1.71028 XP_017533625.1.32401 XP_017705995.1.44346 XP_017823012.1.60252 XP_017919044.1.57651 XP_019294239.1.44245 XP_019294241.1.44245 XP_019488895.1.44202 XP_019567190.1.88060 XP_019833725.1.53367 XP_020014266.1.5219 XP_020953078.1.46622 XP_021074765.1.100879 XP_021547525.1.83697 XP_021547527.1.83697 XP_541337.3.84170 ENSBTAP00000016937 gi|4507791|ref|NP_003960.1| ENSMUSP00000005714 ENSRNOP00000034271 ENSOGAP00000005031 ENSP00000253023 ENSOCUP00000014290 ENSMMUP00000029784 ENSP00000253023 ENSCJAP00000049103 Hs4507791___KOG0420 ENSMUSP00000005714 ENSSTOP00000022397 ENSP00000253023 ENSMMUP00000029784 ENSRNOP00000034271 ENSOCUP00000014290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]