SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000034796 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000034796
Domain Number 1 Region: 388-740
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-86
Family Protein kinases, catalytic subunit 0.00000169
Further Details:      
 
Domain Number 2 Region: 204-304
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 1.7e-41
Family MAST3 pre-PK domain-like 0.00000287
Further Details:      
 
Domain Number 3 Region: 965-1056
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-18
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000034796   Gene: ENSRNOG00000022753   Transcript: ENSRNOT00000037756
Sequence length 1322
Comment pep:known chromosome:RGSC3.4:16:19155246:19169436:1 gene:ENSRNOG00000022753 transcript:ENSRNOT00000037756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSRREKLLIPALTLDLSPSSQSPCLLSPGSPCSPCSPSLGLQQPWSCRSGNRKSLVVGT
PSPTLSRPLSPLSVPTAGNSPLDSPRNFSAAAAINFPFARRADGRRWSLASLPSSGYGTN
TPSSTVSSSSSSRERLHQLPFQPTADELRFLSKHFRSSESVVDEDGGRSPRLRPRSRSLS
PGRTSGTFDNEIVMMNHVYRERFPKATAQMEGRLQDFLAAFAPGDRLALADGVLGFIHHQ
IVELARDCLAKSGEALVTSRYFLEMQDKLERLLQDAHERSDSAEVGFIVQLVRKLLIIIS
RPARLLECLEFDPEEFYHLLEAAEGQAREDQGVKTDLPRYIIRQLGLAKDPLEEIQPLND
LDEGQPPAPGSPESRGLGGPSRRQPCESDFETIKLISNGAYGAVYLVRHRDTRQRFAIKK
INKQNLILRNQIQQVFVERDILTFAENPFVVGMFCSFETRRHLCMVMEYVEGGDCATLLK
NMGPLPVDMARMYFAETVLALEYLHNYGIVHRDLKPDNLLITSLGHIKLTDFGLSKIGLM
SMATNLYEGHIEKDAREFVDKQVCGTPEYIAPEVIFRQGYGKPVDWWAMGVILYEFLVGC
VPFFGDTPEELFGQVVSDEIMWPEGDEALPPDAQDLITRLLRQSPMDRLGTGGTHEVKQH
PFFLALDWAGLLRHKAEFVPQLEAEDDTSYFDTRSERYRHLGSEGDETNDEESSTEIPQF
SSCSHRFSKVYSSSEFLAVQPNPTFAERSFSEDREEGWEQSGEGDGGRRLSTDLRLRSWT
PASSCQPSSCQSDRGPSPSLLSTISLDMPKFAFSSEDEGAGSGPADTRKPVFILGEPDPP
PPTTPVTPKPCNLSADTAVLSHARLRSNSTGARHSTPRPLDAGRGRRLGSSRDPGPEKPR
ASPGGSGGRVPKSASVSALSLIITADDGSGGPLMSPLSPRSLSSNPSSRDSSPSRDPSPV
CGSLRPPIVIHSSGKKYGFSLRAIRVYMGDSDVYTVHHVVWSVEEGSPAQEAGLRAGDLI
THINGESVLGLVHMDVVELLLKSGNKISLRTTALENTSIKVGPARKNVAKGRMARRSKRS
RRRETQDRRKSLFKRISKPSSVLHTSRSFSSGLQHSLSSSESLPGSPTHSLSPSPTTPCR
SPAPDVPTDTASPPSVSPSSSSPASPATGHTRPSSLHGLAAKLGPPRHKSGRRKSTSSIP
PSPLACPPVPTPPPRSPSPLPGHIPIPARSPRLRRGQSADKLGLGTSERLDGDGGRRGRG
AETELVVMRRLHLSERRDSFKKQEAVQEVSFDEEPGPTGAVPKIAVQGAEATPGSPGPAR
ED
Download sequence
Identical sequences ENSRNOP00000034796 10116.ENSRNOP00000034501 XP_006253005.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]