SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000035028 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000035028
Domain Number 1 Region: 238-365
Classification Level Classification E-value
Superfamily Second domain of FERM 9.12e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 367-471
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-24
Family Third domain of FERM 0.0059
Further Details:      
 
Domain Number 3 Region: 10-104
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000101
Family PDZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 149-232
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000599
Family Ras-binding domain, RBD 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000035028   Gene: ENSRNOG00000004118   Transcript: ENSRNOT00000039796
Sequence length 1705
Comment pep:known chromosome:RGSC3.4:X:47683734:47814085:1 gene:ENSRNOG00000004118 transcript:ENSRNOT00000039796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQAIPFDDPRFDSCQIIPPAPRKVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKL
IPGDQIVMINDEPVSAAPRERVIDLVRSCKESILFTVIQPYPSPKSAFISAAKKARLKSN
PVKVRFSEEVIINGQVSETVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQ
EKLSIKGIEHFSLMLEQRTEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPKDP
IDLLRRDPVAFEYLYVQSCNDVVQERFGPELKYDIALRLAALQMYIATVTTKQTQKISLK
YIEKEWGLETFLPSAVLQSMKEKNIKKALSHLVKANQNLVPPGKKLSALQAKVHYLKFLS
DLRLYGGRVFKATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFT
EEESLVRVELHVLDVKPITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNAGTQ
DTGTENKGKHNLLGPDWNCMPQMTTFIGEGEQEAQITYIDSKQKAVEMTDSTLCPKEHRH
LYIDNTYSSDELSQPLTQPGDAPCEADYRSLAQRSLLTLSGPDTLKKAQESPRGAKVSFI
FGDLALDDGMSPPTLGYERMLDENPEMLEKQRNLYISSANDMKNLDLTPDTDSIQFVANS
VYANIGDVKNFEAPEGIEEPLLHDICYAENTDDAEDEDEVSCEEDLVVSEINQPAILDLS
GSSDDIIDLTTLPPPEGDDNEDDFLLRSLNMAIAAPPPGFRDSSDEEDTQSQATSFHENK
EQGSSLQNEEIPVSLIDAVPTSAEGKCEKGLDPTVVSTLEALEALSEEQQKSENSGVAIL
RAYSPESSSDSGNETNSSEMTEGSELAAAQKQSESLSRMFLATHEGYHPLAEEQTEFPTS
KTPSVGLPPKSSHGLAARPATDLPPKVVPSKQILHSDHMEMEPETMETKSVTDYFSKLHM
GSVAYSCTSKRKSKLAEGEGKCPLSGNVPGKKQQGTKIAETEEDTKGKVGTVSSRDNPHL
STFNLERTAFRKDSQRWYVASDGGVVEKSGVEAPAMKAFPRGPGLGNREAEGKEDGTMEG
EADDASGLGQGERFLSDMACVASAKDLDNPEDTDSPTCDHATKLPEAEDNVARLCDYHLA
KRMSSLQSEGHFSLQSSQGSSVDTGCGPGSSSSACATPVESPLCPSMGKHLIPDASGKGG
SYISPEERVAGHPNHGATFKELHPQTEGMCPRMTVPALHTAINADPLFGTLRDGCHRLPK
IKETTALTEPGKERQGGMPSAWSPHPEADPILLPSNIHLESKVPSPNQDPNDFSQGNQAF
GEAVSWRPADLRGGSLRTPPSQRALRHSSSILSGPVGLETFQEGTKGVVSLKYPGITEAQ
EASSERRAELPLGKKLTKSFSQSSMHFISEGKFHKRSPMSHKDSKVYRTLPLRKLESSNW
RCRGPFSYCFLNQGQDEDGDEDEEGEATLQVSCLYRPHITQGMPETSNSSLAVGLQKQGE
ELSRGTVLKDWTEDPDGPDDLDFSSLAFDARIARINALKANTYGMPDGFLEAQNDANELL
CLVRATKAKREESRPEAYDLTLSQYKQLLSIESRQLGSACRKMAMAEKSPEEMLLAMSSS
FQVLCCLTEACMRLVKVVNSETQRQEIVEKIDEVVINYICLLKAAEAATGKTTGDPSIGL
SMRHSTTMAALVSTLTRSLKMLLNK
Download sequence
Identical sequences D4A3K7
ENSRNOP00000035028 NP_001100430.1.100692 NP_001100430.1.4139 ENSRNOP00000035028 10116.ENSRNOP00000035028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]