SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000035426 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000035426
Domain Number 1 Region: 644-942
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.1e-77
Family Protein kinases, catalytic subunit 0.000000197
Further Details:      
 
Domain Number 2 Region: 147-307
Classification Level Classification E-value
Superfamily NAP-like 4.05e-56
Family NAP-like 0.0000000987
Further Details:      
 
Domain Number 3 Region: 344-417
Classification Level Classification E-value
Superfamily HR1 repeat 2.09e-20
Family HR1 repeat 0.0017
Further Details:      
 
Domain Number 4 Region: 304-333
Classification Level Classification E-value
Superfamily HR1 repeat 0.00000942
Family HR1 repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000035426   Gene: ENSRNOG00000025892   Transcript: ENSRNOT00000037401
Sequence length 958
Comment pep:known chromosome:RGSC3.4:3:9084029:9096375:1 gene:ENSRNOG00000025892 transcript:ENSRNOT00000037401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKRQSAILPQPETQTRCCPEAGGQVGLSRPAEGSTFLVLRSDSGFRASVHFSLSSVDR
EVCVSYAQLRVVVWCFPRGLLGSVCFLHSSCEVHNPISGMPRGSSVEQALGSMLAVVTST
NPWIRRCMCWRSLCLGAVRFLSGVFSESVQKSCTAVYDDQSSRMGWKKKEQQEAIEHIDE
VQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLG
EEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTE
IKWKSGKERKLLAAAQQMLKDSQLKVALLRMKISGLEASGSPEPGPDLLAEELQHRLRIE
AAVAAGAKNVVKLLGGQRIQDRKALAEAQAQLQESSQKLDLLRLALELLLERLPPTHSLR
SRVTRELRMAMLGNPQPLGTLVKPIALTGEVLAVLKVDNRVVGQTGWGLVAEKSWDQAFS
ISLDRVTFCEPVIERRPRLQRQRRVFSKRRGQDFLRASQMNLSMTAWGRLVMSLLPPCSS
PSTVSPPKGCPSAAACETSSSASPSMVMRLPAPCDWAQTFPSYSNFRPVKTLPGEDMKPP
PKPPRLYLQEPAPGTPCTKRPHMDPRTGVAPPLAALSTRNPPQLQDFRCLAVLGRGHFGK
VLLVQYKGTGKYYAIKALKKQEVLGRDEIDSLYCEKRILETVGRTGHPFLLSLLACIQTS
SHACFVTEFLPGGDLMMQIHEDVFPEPQACFYLACVVLGLQFLHEKRIIYRDLKLDNLLL
DAQGFLKIADFGLCKEGIGFGDRTSTFCGTPEFLAPEVLTQEAYTRAVDWWGLGVLLYEM
LVGDTEDEVFECIVNADVPCPHFLSAQGLELIQKLLQKSPEKRLGAGERDAEEIKVQPFF
RPPFVPTLCGPADLRYFEGEFTSLPPTLTPPVPRRSLSARQQAAFRDFDFVSKRFLES
Download sequence
Identical sequences D3ZC07
10116.ENSRNOP00000043911 ENSRNOP00000035426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]