SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000036666 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000036666
Domain Number 1 Region: 269-375
Classification Level Classification E-value
Superfamily PDZ domain-like 1.08e-25
Family PDZ domain 0.00000503
Further Details:      
 
Domain Number 2 Region: 136-240
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-24
Family PDZ domain 0.0000413
Further Details:      
 
Domain Number 3 Region: 821-902
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-16
Family PDZ domain 0.0000725
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000036666   Gene: ENSRNOG00000001700   Transcript: ENSRNOT00000039577
Sequence length 920
Comment pep:known chromosome:RGSC3.4:5:80382665:80399920:-1 gene:ENSRNOG00000001700 transcript:ENSRNOT00000039577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAQLDGLSVSSSSTGSLGSAAAAAGGGGGAGLRLLSANVRQLHQALTALLSEPEREQFT
HCLNAYHARRNVFDLVRTLRVLLDSPVKRRLLPMLRLVIPRSDQLLFDQYTAEGLYLPAT
TPYRQPAWAAPDGAGPGEVRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEK
EGLRVGDQILRVNDKSLARVTHAEAVKALKGSKKLVLSVYSAGRIPGGYVTNHIYTWVDP
QGRSTSPPSSLPHGSTLRQHEDDRRSALHLLQSGDEKKVNLVLGDGRSLGLTIRGGAEYG
LGIYITGVDPGSEAESSGLKVGDQILEVNGRSFLSILHDEAVKLLKSSRHLILTVKDVGR
LPHARTTVDQTKWIASSRIGESITNSAGFPGDLTEEGTNKPGFYKGPAGSQVTLSSLGNQ
TRALLDDQARHLLTEQERATMMYYLDQYRGGTISVEALVMALFELLNTHAKFSLLSEVRG
IISPQDLDRFDHLVLRREIESMKARQPPGPGVGDTYSMVSYSDTGSSTGSHGTSTTVSSA
RERLLWLIDLMENTLDLEGTGETTQGSTNALPDVSVDDVRSPSEDLPGIKPPPPPPPLAQ
GHDRLLGQTRKPVREDSAPLSSAAHSGIVFSAPRNRSPPPPPGIAPTPTPGPSSARDSPS
SPIYASISHANPSSRKPLDTHLALVNQHPIGPFPRVQSPPHLKSPPAEAPGAGAGLPPPS
PSEHADAVGANQHFVLVEVHRPDSEPDVNEVRALPQTRTASTLSQLSDSGQTLSEDSGVD
AGETEASTSGRGRQTANTKNKNGKELPQTERTTEGANKPPGLLEPTSTLIRVRKSAATLG
IAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGQTLRGKEHREAARVIAEA
FKTKERDYIDFLVTEFNVML
Download sequence
Identical sequences G3V675
ENSRNOP00000036666 10116.ENSRNOP00000002309 ENSRNOP00000002309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]