SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000036801 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000036801
Domain Number 1 Region: 298-371
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000389
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000036801
Domain Number - Region: 145-194
Classification Level Classification E-value
Superfamily UBC-like 0.0826
Family UBC-related 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000036801   Gene: ENSRNOG00000027249   Transcript: ENSRNOT00000029513
Sequence length 375
Comment pep:known chromosome:RGSC3.4:14:107211442:107276305:1 gene:ENSRNOG00000027249 transcript:ENSRNOT00000029513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTEANLLRHFPLLLPQNREKTVYEGFISAQGRDFHLRIVLPKDQQLKKARLLCSWQLK
NILNEYHQVVQQRMKHSPDLMSFMMELKIILEAALKNKQELYVQPPSCSFCKDLLTEIGA
IGWDKLACVDTSFTTIKLKADDASGRKHLITVKLKAKYPVEPPDCLVDFPIPFSVSWTPQ
SSLVNVYSQFSAALETLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGHDVSINIEV
DPRHPTMLPEFCFLGADHVTKPLGMRLSGNIHLWDPENSLLQNLKDVLEIDFPARTVLEK
SDFSMDCGICYARHLNGAIPDQVCNNPQCGQLFHQMCLYEWLRGLSSSRQSFNVFFGECP
YCSKPITLKMSGRKP
Download sequence
Identical sequences D3ZAU3
NP_001178613.1.100692 NP_001178613.1.4139 ENSRNOP00000036801 ENSRNOP00000036801 10116.ENSRNOP00000036801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]