SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000036805 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000036805
Domain Number 1 Region: 14-145
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.51e-24
Family Calponin-homology domain, CH-domain 0.00086
Further Details:      
 
Domain Number 2 Region: 1033-1150
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000002
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000036805   Gene: ENSRNOG00000009702   Transcript: ENSRNOT00000032917
Sequence length 1726
Comment pep:known chromosome:RGSC3.4:15:85710975:85928469:1 gene:ENSRNOG00000009702 transcript:ENSRNOT00000032917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDAEADCSVAFAEAQRWVEAVTEKNFETRDFRASLENGVLLCDLINKLKPGVVRKINRL
STPIAGLDNINVFLKACEQIGLKEAQLFHPGDLQDLSNRVTVKQEETDRRLKNVLITLYW
LGRKAQNNPYYHGPYLNLKAFETLLGQALTKALEDSSCLKRSGRDSGYGDIWCPDRGDFP
APPGSHRREDSFESLDSLGSRSLTSCSSDLTLRGGREGCESDNDWEFTFKMQDYNKDDMS
YRRISAIEPKSALPFNRFLPNKSKQPSYVPAPLRKKRPDKNEDNRRSWASPVYTETEGTF
SSTQRRAWGPKMENWHTVQETSTSSWCLEEEEEKVTRLPNVVKDDLYVRKLSPVMPSPGS
SFDQFLPKGWTPEDMNWKKIKRETYKPWYKEFQGLSQFLLLQALQTYSDDILSSETNVKL
DPTSGPRLITRRKNFSPTPGYRAHDLEPQSLDPDLENDDFFVRKTRAFHANPCVLRAFED
FRRFSEPDDAVERDIILQCREGELVLPDLEKDDMIVRRIPAQKKEVPLSGAPDRYQPVPF
PEPWTLPPEIQAKFLSVLERTCPPKDKPSSCRVLVPSHRLKKDDMLTRKIQSWKLGTAVP
PISFRPGPCSEADLRKWEAIREASRLRHRKRLMVERLFQKIYGENGSKSLSDVSAEDVQS
LRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALEKSD
RSSKTFREMLQDRESQSSTTTSRRRIYSSDDILDDGVLPPTVTLSETSYQSERLEDKARA
HPAEMPKEDSTTFASREDGIAAEIPLASHIPEERRQAPWPSAETRQASSSSAESHQASLP
STESDQARLPSAEPHQASFSSAEPRQVPLVSAEPHQASSFSSTEPHQASLSSALQRPSSL
SSSQQSWSTRGESTRISASLPRSYQRSDTARLTSVVTARPFGTSSRGISSLPRSYTMDDG
WKYNGDVEVVKREQHDSGRAAGMKPDSSHFILGSSSEKEVATGEDVASLSSFVLPSSSSL
SHDQAASSKATFSSTSGLDSVSDSGEGRSSSLREVSRSPDQFSDMRISINQTPGTKHDFG
FTIKWDVSGISVASVEKGSPAEFSQLQVDDEILAINNTKFSYKDTKKWEEAMANAQETGN
LVMDVRRYGKSGSPETKWIDTTSGIYSTEKSSSLSVTTDFSESLQSPYSESKEINGIHEE
SNAFDSKASESISLKNLKRRSQFFEQGSSDSVAPDLPVPTLSAPSRWAWDQEEERRRQER
WQKEQDRLLQEKYQREQEKLREEWQRAQQEAERENSKYLDEELMVLNSNSISLTSRESVT
ASWEPSWSEGSKSLDREGTRAGDEDRGQLEDDAVYEDQSQKLQERLMLEHEKKRKEQEAQ
EEELRKQREAEAQARAEAEAQARAEAQARAEAQAQAEAEARKRAEAQKLQAERERETSVK
IYQYRRPIDSYDLPKREEESSGLLPIDRSKSRSTTELNDPLIEKSGNSKYSDRIGTTSFS
QRSSKKDQGPSEAELERQQILQEMRKKTSLHNDNSWIRQRSASVNKEPICLTGIMRRGES
LDNLDSQRPGSWRQSSWHSQPAGVYASSSVQDFSRLPPQLLSTSNRAYMRNPSSAVPPLA
GSVKTSPGSPSPRSHSPSMSQSGSQLRNRSVSGKRVCSYCNSILGKGAAMIIETLGLCYH
LHCFKCVSCERDLGGSSSGAEVRIRNHQLYCNDCYLRFKSGRPTAM
Download sequence
Identical sequences 10116.ENSRNOP00000036805 ENSRNOP00000036805 ENSRNOP00000036805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]