SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000036881 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000036881
Domain Number 1 Region: 11-81
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000485
Family PDZ domain 0.055
Further Details:      
 
Domain Number 2 Region: 94-180
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000189
Family PDZ domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000036881   Gene: ENSRNOG00000023386   Transcript: ENSRNOT00000039065
Sequence length 454
Comment pep:known chromosome:RGSC3.4:3:52895147:52923750:1 gene:ENSRNOG00000023386 transcript:ENSRNOT00000039065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLK
ANVEKPVKMLIYSSKTLELREASVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVES
NSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITP
NSAWGGEGSLGCGIGYGYLHRIPTRPFEEGKKISLPGQMTGTPMTPPKDGFTEVQLSSVS
PPSLSPPGTAGVEQSLSGLSISSAPPAVSNVLSTGVPTVPLLPPQVNQSLASVPPMNPAA
TLPSLMPLSAGLPSLPNLPSLSNFNLPAPHIMPGVGLPELGKPGLPPLPSLPPRNLPGIA
PLPMPSDFLPSFPLVPEGSSAASAGEPLSSLPAMGPPSDPVMTTAKADTSSLTVDVMSPA
SKVPTTVEDRVSDCTPAMEKPVSAVTDANASEAS
Download sequence
Identical sequences Q68G33
10116.ENSRNOP00000036881 NP_001007721.1.100692 NP_001007721.1.4139 ENSRNOP00000036881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]