SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000037119 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000037119
Domain Number 1 Region: 217-383,681-899,954-1008
Classification Level Classification E-value
Superfamily Ras GEF 2.48e-114
Family Ras GEF 0.00012
Further Details:      
 
Domain Number 2 Region: 366-450
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-17
Family PDZ domain 0.005
Further Details:      
 
Domain Number 3 Region: 95-220
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000000263
Family cAMP-binding domain 0.0008
Further Details:      
 
Domain Number 4 Region: 591-670
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000336
Family Ras-binding domain, RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000037119   Gene: ENSRNOG00000021581   Transcript: ENSRNOT00000029340
Sequence length 1478
Comment pep:known chromosome:RGSC3.4:2:170472420:170522450:-1 gene:ENSRNOG00000021581 transcript:ENSRNOT00000029340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEAGDMDLSGL
PETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFAN
MTMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPDGKAEILCMGNS
FGVSPTMDKEYMKGVMRTKVDDCQFVCIAQQDYCRILNQVEKNMQKVEEEGEIVMVKEHR
ELDRTGTRKGHIVIKGTSERLTMHLVEEHSVVDPTFIEDFLLTYRTFLSSPMEVGKKLLE
WFNDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEFENNLEREKMGGHLRLLNIACA
AKAKRRSMTLTKPSREAPLPFILLGGSEKGFGIFVDSVDSSSKATEAGLKRGDQILEVNG
QNFENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEEKRNGAPHLPKIGDIKKAS
RYSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKTRISILPQKPYNDIGIGQS
QDDSIVGLRQTKHIPAALPVSGTLSSSNPDLLQSHHRILDFSTTPDLPDQVLRVFKADQQ
SRYIMISKDTTAKEVVIQAIREFAVTATPEQYSLCEVSVTPEGVIKQRRLPDQLSKLADR
IQLSGRYYLKNNMETETLCSDEDAQELLRESQISLLQLSTVEVATQLSMRNFELFRNIEP
TEYIDDLFKLKSKTSCANLKKFEEVINQETFWVASEILRETNQLKRMKIIKHFIKIALHC
RECKNFNSMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDLQDLFDPSRNMAKYRNVLS
GQNLQPPVIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMIAKEIRHVGRMASVNMDPA
LMFRTRKKKWRSLGSLSQGSANATVLDVAQTGGHKKRVRRSSFLNAKKLYEDAQMARKVK
QYLSNLELEMDEESLQTLSLQCEPATSTLPKNPADRKPVKSETSPVAPRAGPQQKAQPQQ
PLAPPQPSHKVSQGLQVPAVSLYPSRKKVPVKDLPPFGINSPQALKKILSLSEEGSLERH
RKQAEDTISNASSQLSSPPTSPQSSPRKGYALALSGTVDNFSDSGHSEISSRSSIVSNSS
FDSVPVSLHDERRQRHSVSIVESNLGVGRMERRTLMEPDQYSLGSYAPVSESRGLYAAAT
VISSPSTEELSHDQGDRASLDAADSGRGSWTSCSSGSHDNIQTIQHQRSWETLPFGHTHF
DYSGDATGIWASGGHMDQIMFSDHSTKYNRQNQSRESLEQAQSRASWASSTGYWGEDSEG
DTGTIKRRGGKDVSTEAESSSMVPVTTEEAKPVPMPAHIAVTPSTTKGLIARKEGRYREP
PPTPPGYVGIPIADFPEGPCHPARKPPDYNVALQRSRMVARPTEAPAPGQTPPAATASRP
GSKPQWHKPSDADPRLAPFQPQGFAGAEEDEDEQVSAV
Download sequence
Identical sequences 10116.ENSRNOP00000037119 ENSRNOP00000037119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]