SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000037329 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000037329
Domain Number 1 Region: 820-907
Classification Level Classification E-value
Superfamily ARM repeat 0.00000184
Family PBS lyase HEAT-like repeat 0.059
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000037329
Domain Number - Region: 137-186
Classification Level Classification E-value
Superfamily HR1 repeat 0.00968
Family HR1 repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000037329   Gene: ENSRNOG00000010791   Transcript: ENSRNOT00000035463
Sequence length 938
Comment pep:known chromosome:RGSC3.4:3:159120632:159147922:-1 gene:ENSRNOG00000010791 transcript:ENSRNOT00000035463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLRFLSPGEAGAVGTVGRSASFAGFSSAQSRRVSKSINRNSVRSRLPAKSSKAYGTL
RKGSLCLDPRPQQVKKIFDALKRGLREHLCEQQAELDYLCRCHTDTQRSSRLAFYYDLDK
QMRMVERHIRKVEFHISKVDELYEGYCIQWRLRDGASNMQRAFSNSTQSRASRESLQELG
RSLQECLEDMCLIEGTLEGHLGEFHVKMKGLVGYARLCPGDQYEVLMRLGRQRWRLKGRI
EPDDSQTWDEEERVFVPTVHENLEIKVTELRGLGSMVVGAVTCDVADFFTARPQLVVVDI
TELGTIKLQLELLWNPLDSECRLVSPSPTGRFSVGSRKGSLYTWTPPSTPSFRDKYYLSV
LQQPMQQALLLGGPRATSILGYLSDSELQGPRLRSRSQELLEMDSFSSEDPRDTETSTSA
STSDVGFLPMPVAPTACIEEETREEPPPLGLLPGLTHPAGGVLVEQPGWRDLRGERLDLL
LDDPIHSPTVPRSRKGQEDGGAGDGVEGPVQEVLDLLRSADPAQPQLRELEYQVLGLRER
LKPRGVQPEPVSAQSLMDCILESFAFLNADLASDELSLFGGSQALERDSPPPPRPSLKVS
PSELTAGTPELDTLLTVHLQVCKALLQKLASPNLSRMVQDCLLEEAVQQRQVLEVLSDLD
LEQVSKAKSVEEIIPQASQRKGGLALWQGCTQPGGVLACPASTLLSQLKKTFLHRVRGKY
PGQLEIVCRRLLEQVLGCGGLFVTAGLQDEQVVTWFQFHSYLQRQNISDLEKHLTQLTKE
VTLIEELNCAGPAKALRKLHGKRLSQLQPLPQTLQAWARLQLDGPPRLCRAARMRLASAA
RNKRFREKALLYYTNALNDSDSKLQQAACMALQQLGGVESIEQIVSLCQSDLEAVRAAAR
EATLSFGEKGRLAFEKMDKLHAEQEAFCQEADVEITIF
Download sequence
Identical sequences 10116.ENSRNOP00000037329 XP_006235712.1.100692 ENSRNOP00000037329 ENSRNOP00000037329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]