SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000037380 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000037380
Domain Number 1 Region: 347-484
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.28e-41
Family Nucleotide and nucleoside kinases 0.0000629
Further Details:      
 
Domain Number 2 Region: 194-337
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-31
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 122-210
Classification Level Classification E-value
Superfamily PDZ domain-like 8.81e-17
Family PDZ domain 0.00056
Further Details:      
 
Domain Number 4 Region: 54-108
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000547
Family L27 domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000037380   Gene: ENSRNOG00000021579   Transcript: ENSRNOT00000029332
Sequence length 496
Comment pep:known chromosome:RGSC3.4:4:78343494:78422515:1 gene:ENSRNOG00000021579 transcript:ENSRNOT00000029332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELV
NEILEDITPLISVDENVAELVGILKEPHFQSLLEAHDIVASKCYESPPSSPEMNIPSLNN
QLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNG
HEVGNNPKELQELLKNISGSVTLKILPSYRDTIAPQQSYVNMERHPAHVRQVFVKCHFDY
NPFNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAF
ARRDWDNSAGSCGGISSIKKVTIIHISSKNTEFDRHEIQIYEEVAKMPPFQRKTLVLIGA
QGVGRRSLKNRFIVLNPARFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLE
HGEYEGNLYGTKIGSILDVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRA
MHKAVVDAGITTKLLT
Download sequence
Identical sequences 10116.ENSRNOP00000037425 ENSRNOP00000037380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]