SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000037674 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000037674
Domain Number 1 Region: 77-212
Classification Level Classification E-value
Superfamily TRAF domain-like 1.24e-23
Family SIAH, seven in absentia homolog 0.0061
Further Details:      
 
Domain Number 2 Region: 244-342
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-23
Family PDZ domain 0.0000289
Further Details:      
 
Domain Number 3 Region: 414-504
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-21
Family PDZ domain 0.00000848
Further Details:      
 
Domain Number 4 Region: 10-81
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000177
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000037674   Gene: ENSRNOG00000005632   Transcript: ENSRNOT00000039201
Sequence length 1063
Comment pep:known chromosome:RGSC3.4:4:136045129:136254967:-1 gene:ENSRNOG00000005632 transcript:ENSRNOT00000039201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFELDRFDGEVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCPSRCRGRL
SAKELNHVLPLKRLILKLDIKCAHAARGCGRVVKLQDLPEHLERCDFAPARCRHAGCGQL
LLRRDVEAHMRDACDARPVGRCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQARLGAL
HKALKKEALRAGKREKSLVAQLAAAQLELQMTALRYQKKFTEYSARLDSLSRCVAAPPGG
KGEETKSVTLVLHRDSGSLGFNIIGGRPCVDNQDGSSSEGIFVSKIVDSGPAAKEGGLQI
HDRIIEVNGKDLSRATHDQAVEAFKTAKEPIVVQVLRRTPRTKMFTPASESQLVDTGTQT
DITFEHIMALTKISSPSPPVLGPYLLPEEHPSSHEYYDPNDYMGDIHQDMDREELELEEV
GLYRMNSQDKLGLTVCYRTDDEDDIGIYISEIDPNSIAAKDGRIREGDRIIQINGIEVQN
REEAVALLTSEENKNFSLLIARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTA
SVLQQKKHEEDGGTTDTATILSNQHEKDSGVGRTDESTRNDESSEQENNGEDATASSNPL
AGQRKLTCSQDTLGSGDLPFSNESFISADCTDVDYLGIPEDECERFRELLELKCQVQSTS
PYSLYYPNSPLDAAGKGDPESVDKELELLNEELRSIELECLSIVRAHKMQQLKEQYRESW
MLHHSGFRNYNTSVDVRRHELSDITELPEKSDKDSSSAYNTGESCRSTPLTLEISPDNSL
RRVAEGSSEGATANMEAYRPSPKNLLAITEDPEVSTPNYNPGAKELDPSQALEIKERRVS
DGSRSPTASPKLGSAYLPSYHHSPYKHAHIPAHAQHYQSYMHLIQQKSAVEYAQSQMSLV
SMCKDLNSSNSAEPRMEWKVKIRSDGTRYITKRPVRDRLLRERALKIREERSGLTTDDDA
MSEMKMGRYWSKEERKQHLVKAKEQRRRREFMMQSRLDCLKEQQASDDRKEMNILELSHK
KMMKKRNKKIFDNWMTIQELLTHGTKSPDGTRVYNSFLSVTTV
Download sequence
Identical sequences ENSRNOP00000037674 10116.ENSRNOP00000037674 NP_001258180.1.100692 NP_001258180.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]