SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000037789 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000037789
Domain Number - Region: 399-476
Classification Level Classification E-value
Superfamily Family 10 polysaccharide lyase 0.0016
Family Family 10 polysaccharide lyase 0.018
Further Details:      
 
Domain Number - Region: 516-614
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 0.085
Family Class I alpha-1;2-mannosidase, catalytic domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000037789   Gene: ENSRNOG00000025372   Transcript: ENSRNOT00000038641
Sequence length 618
Comment pep:known chromosome:RGSC3.4:8:66201939:66214229:-1 gene:ENSRNOG00000025372 transcript:ENSRNOT00000038641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCLAARVNYKTLIIICALFTLVTVLLWNKCSSDKAIQFPRHLSSGFRVDGLEKRSAASE
SNHYANHIAKQQSEEAFPQEQQKAPPVVGGFNSNGGSKVLGLKYEEIDCLINDEHTIRGR
REGNEVFLPFTWVEKYFDVYGKVVQYDGYDRFEFSHSYSKVYAQRSPYHPDGVFMSFEGY
NVEVRDRVKCISGVEGVPLSTQWGPQGYFYPIQIAQYGLSHYSKNLTEKPPHIEVYETAE
DRDRNIRPNEWTVPKGCFMASVADKSRSTNVKQFIAPEAGEGVSLQLGNTKDFIISFDLK
FLTNGSVSVVLETTDKNQLFTVHYVSNTQLIAFKDRDIYYGIGPRTSWSTVTRDLVTDLR
KGVGLSNTKAVKPTKIMPKKVVRLIAKGKGFLDNITISTTAHMAAFFAASDWLVRNQDEK
GGWPIMVTRKLGEGFKSLEPGWYSAMAQGQAISTLVRAYLLTKDYVFLNSALRATAPYKF
LSEQHGVKAVFMNKHDWYEEYPTTPSSFVLNGFMYSLIGLYDLKETAGEKLGKEARSLYE
RGMESLKAMLPLYDTGSGTIYDLRHFMLGIAPNLARWDYHTTHINQLQLLSTIDESPIFK
EFVKRWKSYLKGSRAKHN
Download sequence
Identical sequences D3ZIK0
ENSRNOP00000037789 10116.ENSRNOP00000037789 XP_001073932.1.4139 XP_017451539.1.100692 XP_017459139.1.4139 XP_343405.2.100692 ENSRNOP00000037789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]