SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000038050 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000038050
Domain Number 1 Region: 200-358
Classification Level Classification E-value
Superfamily UBC-like 3.63e-33
Family UBC-related 0.000000144
Further Details:      
 
Domain Number 2 Region: 7-88
Classification Level Classification E-value
Superfamily UBC-like 0.000000000131
Family UBC-related 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000038050   Gene: ENSRNOG00000023261   Transcript: ENSRNOT00000035153
Sequence length 372
Comment pep:known chromosome:RGSC3.4:X:21894047:21895165:-1 gene:ENSRNOG00000023261 transcript:ENSRNOT00000035153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGLKAELEFLASIFDKDHERLRIVSWQLDELQCQFLVPPAPAGSPPLPPPLTLHCTIT
ESYPSSPPIWFVDSDDPDLTSILERLEDSKPNSSLRQQLKWLICELCSLYNLPEHLDVKM
LDQPVPIAQKATIEEVPSEDEEEDAADGLEDLDHYELKEDTCSEKKSEDEGLEKEHLAIL
ENIKKSQRQEHLNGTVSGSVHASNRLMKELREIYRSQSYKSGTYSVELINDSLYDWHVKL
RKVDPDSPLYGDLQLLKEKEGIEYILLNFSFKDNFPFDPPFVRVELPILSGGYVLGGGAL
CMELLTKQGWSSAYSIESVIMQINATLVKGKARVRFGADKNQYNLETAQQSYDSVVQMHE
KKGWFTPPKEDG
Download sequence
Identical sequences D4ADP2
10116.ENSRNOP00000038050 NP_001129469.1.100692 NP_001129469.1.4139 ENSRNOP00000038050 ENSRNOP00000038050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]