SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000038137 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000038137
Domain Number 1 Region: 193-304
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-28
Family PDZ domain 0.0025
Further Details:      
 
Domain Number 2 Region: 313-424
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-24
Family PDZ domain 0.00000394
Further Details:      
 
Domain Number 3 Region: 25-120
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000125
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000038137   Gene: ENSRNOG00000024345   Transcript: ENSRNOT00000038688
Sequence length 1035
Comment pep:known chromosome:RGSC3.4:9:60772669:61275947:1 gene:ENSRNOG00000024345 transcript:ENSRNOT00000038688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSAQNLENRDVMNGEQTGLLMLHKTKNELSDMTRAVEISGEGDPLGIHVVPFFSSLSGRI
LGLFIRGIEENSRCKQEGLFQENECIVKINNVELLDKTFAQAQDVFRQAMKSPSVVLHVL
LPQNREQYEKSVIGQLNIFGNNDSASRTKAPPPTRGKAGLKAVNPTRANSPEGEESPSPQ
QSKSPRVPRLGRKPSSPSLSPLMGFGSKKNAKKIKIDLKKGPEGLGFTVVTRDSSIHGPG
PIFVKNILPKGAAVKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETVSLVIAR
QEGSFLPRELKGEPDCYALSLESSEQLTLEIPLNDSGSAGLGVSLKGNKSRETGTDLGIF
IKSIIHGGAAFKDGRLRMNDQLIAVNGETLLGKSNHEAMETLRRSMSMEGNIRGMIQLVI
LRRLERPLEEISECGALSRPCFENCQEALSASRRNDSSLLYPCGTYSPQDKRKDLLLPSD
GWAENEVPPSPPPHPSLEWGLEDFSHSSRVDSTGYFPDQHVNFRIVTPVGQPESINLKAS
KSMDLVPDESKVQSLADRRSDSPGKDFGPTLGLKKSSSLESLQTAVAEVRKNDLPFHRPR
PHMVRGRGCNESFRAAIDKSYDGPEEAEADGLSDKSSHSGHTALNCESAPQGNPELDDVE
NKAKNVKKTKEKEKKKGKGKMKVKEKKQKEEHEDTERKMKRKGFGAMLRFGKKKDDKVGK
TEQKGTQKSGHPGEEELERMKEERERIGAKHQELREKQARGLVDYATVATGPVHDIDDDE
MDPNYARVNHFREPCTSANVFRSPSPPRAGTLGYPRDGRPLSPDHLEGLYAKVNKPYHPP
ALADSGRPMAGTTDRIQKLRKEYYQARREGFLLYEDEEGVTRPSDYDLHWVSGKGPDGSA
HNLRFEGMERQYASLPRGGSADPVDYLTASPRGRYNERELPYYPGPHPVHSPRGSYPRPP
DLRVTDLRYPQYYPPPPAHQHKGPFRQDVPPSPPQHQRVPVYQEMGRAGPRGGSPDQYPY
RNQDPRQKNPMTAAV
Download sequence
Identical sequences ENSRNOP00000038137 10116.ENSRNOP00000039831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]