SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000039001 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000039001
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily UBC-like 1.2e-40
Family UBC-related 0.00000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000039001   Gene: ENSRNOG00000030467   Transcript: ENSRNOT00000044319
Sequence length 153
Comment pep:known chromosome:RGSC3.4:3:68000239:68016327:1 gene:ENSRNOG00000030467 transcript:ENSRNOT00000044319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASKRVAKELDDLSKELPPYLRHLSSDDANVLVWHMLLLPDQLPYRLKAFGLRIDFPRE
YPLKPPTLRFTTKIYHPNISEDGLVCLPLISTENWKPYTKAYQVLEALNILVSRPNLEEP
VRLELADLLTQDPEMFRKKAEEFTLQYGVDRPS
Download sequence
Identical sequences Q4V8J2
10116.ENSRNOP00000039001 ENSRNOP00000039001 NP_001019926.1.100692 NP_001019926.1.4139 ENSRNOP00000039001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]