SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000039159 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000039159
Domain Number 1 Region: 5-141
Classification Level Classification E-value
Superfamily UBC-like 8.93e-40
Family RWD domain 0.000000805
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000039159
Domain Number - Region: 174-231
Classification Level Classification E-value
Superfamily Acylphosphatase/BLUF domain-like 0.023
Family Acylphosphatase-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000039159   Gene: ENSRNOG00000001599   Transcript: ENSRNOT00000050902
Sequence length 290
Comment pep:known chromosome:RGSC3.4:11:27189247:27197900:-1 gene:ENSRNOG00000001599 transcript:ENSRNOT00000050902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEMEQAEAQLSELDLLASMFPGENELIVNDQLALAELKDCIEKRTMEGRSSKVYFTINV
SLDFNEAAMVMFSLSCILPFKYPTVLPEITVRSVSLSRSQQTQLNTDLTAYLQKHCLGEV
CILNATEWVKEHASDYVNRDASPSPARQSTVQPVDLTFTRLWIYSHHIYNKCKRRNILEW
ARELSLSGFSMPGKPGVVCVEGPQSACEEFWSRLRKLNWKRILIRHREDIPFDSTTEKME
EQRKFSIFEEKAFNVHGARGNHMDFGQLYQFLNARGCGDVFQMFFGVEGQ
Download sequence
Identical sequences B1WBW2
10116.ENSRNOP00000039159 ENSRNOP00000039159 NP_001094029.1.100692 NP_001094029.1.4139 ENSRNOP00000039159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]