SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000039585 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000039585
Domain Number - Region: 389-514
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 0.034
Family Cryptochrome/photolyase, N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000039585   Gene: ENSRNOG00000000219   Transcript: ENSRNOT00000048890
Sequence length 670
Comment pep:known chromosome:RGSC3.4:8:122048919:122095655:-1 gene:ENSRNOG00000000219 transcript:ENSRNOT00000048890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGILSTVDTCESSFTPLVVIELAQDVKEETKEWLKSRIISPKKDGGAQLLFRPLLNKYE
KETLENQNLYLVGASNIRLLLGAEAVGLVKECTDGAMRAFTYRTRHNFKGFHGNNDDFLT
MAECQFIIKHELENLRARDEKMIPGYPQAKLYPGKSLMRRLLTSGIVTQVFPLHDTEALK
KLEDTWYTRFALKYQPIDSIRGYFGETIALYFGFLEYFTFALIPMAVIGLPYYLFVWEDY
DKYVIFASFNLIWSTVILEVWKRGCANMTYRWGTLVMKRQFEEPRPGFHGVLGINSVTGR
EEPVYSSYKRQLRTYLVSLPFVCLCLYFSLYVMMIYFDMEDWALSLHEDSGSEWTSLLLY
VPSIVYAIVIEIMNRLYRYAAEFLTSWENHRLESAYQNHLVLKVLVFNFLNCFASLFYIA
FVLKDMKLLRQSLATLLITSQILNQVVESLLPYWLQRKYCARVKRKVRALKSDVDTTLYE
QVLLEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRV
FKRPFSEPSASIGVWQLAFETMSVISVVTNCALIGMSPQVNAVFPESKTDLVLIVVAVEH
ALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQVRAVRLETLSDCIPLAQEPSHC
VSLSTDSVSK
Download sequence
Identical sequences ENSRNOP00000029074 10116.ENSRNOP00000029074 ENSRNOP00000039585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]