SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000039601 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000039601
Domain Number 1 Region: 113-174
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 3.91e-23
Family Transcriptional factor domain 0.0000837
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000039601   Gene: ENSRNOG00000026008   Transcript: ENSRNOT00000042864
Sequence length 438
Comment pep:known chromosome:RGSC3.4:11:64972306:65006125:1 gene:ENSRNOG00000026008 transcript:ENSRNOT00000042864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPDVLTEVPAALKRLAKYVIRGFYGIEHVLALDILIRNPCVKEEDMLELLKFDRKQLR
SVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERN
STNRASFKCPVCCSTFTDLEANQLFEPMTGTFRCTFCQAEVEEDESAMPKKDARTLLARF
NEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDRAASAAGAAGLAGGHHREAWT
NKGPSYEDLYTQNVVISMDDQDDVHRTSLEGKAAKERPIWLRESTVQGAYGSEEMKEGGI
DMDTFQDREEARAGPDDNEEVMRALLIHEKKTSSATAGSVGAAAPVTAANGSDSESETSE
SDDDSPPRPAAAAPHHRDEDEEDDEFEEVADDPVVMVAGCPFSYSEVSQRPELVAQMTPE
EKEAYIAMGQRMFEDLFE
Download sequence
Identical sequences G3V992
ENSRNOP00000039601 10116.ENSRNOP00000039601 ENSRNOP00000039601 NP_001094026.1.100692 NP_001094026.1.4139 XP_008766953.1.100692 XP_017453488.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]