SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000039621 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000039621
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily UBC-like 2.15e-64
Family UBC-related 0.000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000039621   Gene: ENSRNOG00000034016   Transcript: ENSRNOT00000049772
Sequence length 147
Comment pep:known chromosome:RGSC3.4:14:2470618:2471061:-1 gene:ENSRNOG00000034016 transcript:ENSRNOT00000049772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKRIHKELNDLAQDPPAQCSAGPVGEDMFHWQATIMGPNDSPYQGGAFFLTIDFPTEY
PFKPPKVEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVLLSISSLLCDPNPDDPLV
PEIAQIYKTDRDKYNRTAREWTQKYAM
Download sequence
Identical sequences A0A1U7QN88 G3HEC7 P70711 Q6ZWY6
10090.ENSMUSP00000072387 10116.ENSRNOP00000039621 ENSMUSP00000072387 NP_001263326.1.92730 NP_112263.1.100692 NP_112263.1.4139 XP_003502398.1.69978 XP_005077451.1.91757 XP_007611462.1.28591 XP_021066472.1.100879 ENSRNOP00000039621 ENSMUSP00000072387 ENSMUSP00000072387 ENSRNOP00000039621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]