SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000039762 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000039762
Domain Number 1 Region: 787-797,824-1186
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 2.09e-96
Family Formin homology 2 domain (FH2 domain) 0.0000246
Further Details:      
 
Domain Number 2 Region: 264-348
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-22
Family PDZ domain 0.005
Further Details:      
 
Domain Number 3 Region: 6-79
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000108
Family PDZ domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000039762   Gene: ENSRNOG00000030927   Transcript: ENSRNOT00000044378
Sequence length 1202
Comment pep:known chromosome:RGSC3.4:12:11525112:11546184:-1 gene:ENSRNOG00000030927 transcript:ENSRNOT00000044378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATNQGWPEDFGFQLGGSGPCFVIEVAEGSSAHAGGLRPGDQILEVEGLAVGGLSCEQL
VRLARRCPRVPPSLGVLPGPEGGPTALTAAWLSPRFGRSFPLGRELLRLAGGARPDAVHR
ERRRKAQEFSCQVDDILGDQPTAKEQVFAALKQFAAEQRVDELVWTLILVLPSEAQGPVL
DNLRIFIPKKHRARFDEVVSQGLLGKLCRARRAQGAQRLRRSRSEERPERLLVSTRASAA
PRRPDEPPPRKAASLLGGRTGPGGPRRTVRVYKGNKSFGFTLRGHGPVWIESVLPGSPAE
NASLKSGDRILFLNGLDMRNCSHDKVVSMLQGSGAMPTLVVEEGPVPFASDSDSLDSPTR
ASALTSLQWVADILPSSIRVQGRTFSQQLDHLLTPPERYGVCRALESFFQHRSIDTLIVD
VYPVLDTPAKQVLWQFLYQLLTYEEQELCQEKIACFLGYTAITEPESSLDLEPESTPEPT
PEPQPRSSLRASSMCRRSLRSQGLEASLSCGPGDCSEMPLPLIPGERQAGDGTSLPETPN
PKMMSAVYAELESRLNSGFKGKIGTVSKSRASPPVPSLVGTSGPRTLSGVSWPGDRLLPS
PCYDPLCSGGLASPSSSESHPYASLDSSRAPSPQPGLGSIHPDSPPSPDPIRPPSRRKLF
AFSRPVRSRDTDRFLDVLSEQLGPRVTIVDDFLTPENDYEEVGIKSAGGLFHCRLPQTAS
KPASALDPGSRLQGSSLTSHLLPPPPPPXPPPLPFHDPKPSSGTCDGPRGPPQSLTKPLH
QISHPVPPPPPPPLPPPVPCAPPMISRGVGHRRSETSHMSVKRLRWEQVENSEGTIWGQL
GEDSDYDKLSDMVKYLDLELHFGTQKPPKPVPGPEPFRKKEVVEILSHKKAYNTSILLAH
LKLTPGELRQVLMSMEPRRLEPAHLAQLLLFAPDADEEQRYQAFREAPGRLSEPDQFVLQ
MLSVPEYKTRLRSLHFQATLQEKTEEIRGSLECLRQASLELKNSRKLAKILEFVLAMGNY
LNDGQPKTNKTTGFKINFLTELNSTKTVDGKSTFLHILAKSLSQHFPELLGFAQDLPTVP
LAAKVNQRALTVDLADLHDTVSEIQVACQSMVPSSEDRFAVVMTSFLETAQPALRALDGL
QREAMEELGKALAFFGEDSKATTSEAFFGIFSEFMSKFERALSDLQAGDGPRSSGMVSPL
AW
Download sequence
Identical sequences ENSRNOP00000039762 10116.ENSRNOP00000060420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]