SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000039863 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000039863
Domain Number 1 Region: 7-144
Classification Level Classification E-value
Superfamily UBC-like 2.2e-39
Family UBC-related 0.000000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000039863   Gene: ENSRNOG00000001829   Transcript: ENSRNOT00000040575
Sequence length 145
Comment pep:known chromosome:RGSC3.4:11:87228040:87249726:1 gene:ENSRNOG00000001829 transcript:ENSRNOT00000040575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYEN
RIYSLKVECGSKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQ
ELRRLMMSKENMKLPQPPEGQTYNN
Download sequence
Identical sequences A0A1S3ACS5 A0A1U7R352 Q7M767
ENSRNOP00000039863 ENSRNOP00000062102 NP_898875.1.100692 NP_898875.1.4139 XP_005080067.1.91757 XP_005370429.1.66349 XP_007533064.1.11023 XP_007643064.1.69978 XP_021513389.1.76796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]