SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000039911 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000039911
Domain Number 1 Region: 300-716
Classification Level Classification E-value
Superfamily Nitric oxide (NO) synthase oxygenase domain 1.83e-201
Family Nitric oxide (NO) synthase oxygenase domain 0.0000000000000607
Further Details:      
 
Domain Number 2 Region: 751-836,871-982
Classification Level Classification E-value
Superfamily Flavoproteins 1.03e-52
Family Cytochrome p450 reductase N-terminal domain-like 0.0000000126
Further Details:      
 
Domain Number 3 Region: 13-108
Classification Level Classification E-value
Superfamily PDZ domain-like 1.13e-21
Family PDZ domain 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000039911   Gene: ENSRNOG00000001130   Transcript: ENSRNOT00000046205
Sequence length 1046
Comment pep:known chromosome:RGSC3.4:12:39811145:39869484:-1 gene:ENSRNOG00000001130 transcript:ENSRNOT00000046205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEENTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTQPLGPPTKAVDLSHQPSASKDQSLAVDRVTGLGNGPQHAQGHGQGAGSVSQANGVAI
DPTMKSTKANLQDIGEHDELLKEIEPVLSILNSGSKATNRGGPAKAEMKDTGIQVDRDLD
GKSHKAPPLGGDNDRVFNDLWGKDNVPVVLNNPYSEKEQSPTSGKQSPTKNGSPSRCPRF
LKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLPSQHTRKPEDVRTKDQLFPLAKE
FLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQ
WSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLI
RYAGYKQPDGSTLGDPANVQFTEICIQQGWKAPRGRFDVLPLLLQANGNDPELFQIPPEL
VLEEPIWHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCD
NSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIK
HMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTN
GTPTKRRAIGFKKLAEAVKFSAKLMGQPMAKRVKATILYATETGKSQAYAKTLCEIFKHA
FDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKY
PEPLRFFPRKGPSLSHVDSEAHSLVAARDSQHRSYKVRFNSVSSYSDSRKSSGDGPDLRD
NFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEA
FRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTYVAEAPDLTQGLSN
VHKKRVSAARLLSRQNLQSPKSRRET
Download sequence
Identical sequences 10116.ENSRNOP00000062735 ENSRNOP00000039911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]