SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000040243 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000040243
Domain Number 1 Region: 375-565
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 4.05e-83
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0000000058
Further Details:      
 
Domain Number 2 Region: 29-123
Classification Level Classification E-value
Superfamily A heparin-binding domain 5.23e-45
Family A heparin-binding domain 0.0000015
Further Details:      
 
Domain Number 3 Region: 124-188
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 2.62e-29
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.00001
Further Details:      
 
Domain Number 4 Region: 286-343
Classification Level Classification E-value
Superfamily BPTI-like 8.94e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000040243   Gene: ENSRNOG00000006997   Transcript: ENSRNOT00000044081
Sequence length 770
Comment pep:known chromosome:RGSC3.4:11:24457855:24693851:-1 gene:ENSRNOG00000006997 transcript:ENSRNOT00000044081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSLALLLLAAWTVRALEVPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTK
TCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVG
EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR
GVEFVCCPLAEESDSIDSADAEEDDSDVWWGGADTDYADGGEDKVVEVAEEEEVADVEEE
EAEDDEDVEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC
RAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSVSSQSLLKTTSEPLPQD
PVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
QAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER
MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET
KTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTENEVEPVDARPAADRGLTTRPGSGLTN
IKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Download sequence
Identical sequences P08592
ENSRNOP00000041613 NP_062161.1.100692 NP_062161.1.4139 10116.ENSRNOP00000041613 ENSRNOP00000040243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]