SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000040376 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000040376
Domain Number 1 Region: 12-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.26e-39
Family Forkhead DNA-binding domain 0.0000348
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000040376
Domain Number - Region: 261-292
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.0458
Family Ribosomal L11/L12e N-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000040376   Gene: ENSRNOG00000032137   Transcript: ENSRNOT00000052350
Sequence length 363
Comment pep:known chromosome:RGSC3.4:1:220325650:220326927:-1 gene:ENSRNOG00000032137 transcript:ENSRNOT00000052350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPGKSSYSDQKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNS
LRHNLSFNDCFIKIPRRPDQPGKGSFWALHPDCGDMFENGSFLRRRKRFKVLRADHAHLH
SGSSKGAPGTGPGGHPHMVPYFHQQPAPAPQPPHLPSQPAQQPPPQSQPPQTSHPGKMQG
SVGRLSQFPPYGLGSSTTGFKHPFAIENIIGRDYKGVLQAGGLPLASVMHHLGYPVPGQL
GNVVGSVWPHVGVMDSVAAAAAAAAAAGVPVGPEYGAFGVPVKALCHSANQSLPAVPVPI
KPTPALPTTLPPALAVPTASQQLPAPSTVCAAAASPTAPLLEPTAAGRADSKGGSLHSVL
VHS
Download sequence
Identical sequences 10116.ENSRNOP00000040376 ENSRNOP00000040376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]