SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000040507 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000040507
Domain Number 1 Region: 30-95
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000171
Family PDZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000040507   Gene: ENSRNOG00000028778   Transcript: ENSRNOT00000045890
Sequence length 107
Comment pep:known chromosome:RGSC3.4:7:130909891:130914500:1 gene:ENSRNOG00000028778 transcript:ENSRNOT00000045890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLERRYQEKLAQYMAHTRNFVGDRGGRGQDGEQKPFTVVLEREDDTLGFNIIGGRPNQSS
QKQSAPEGIYVSKILENGPADRADGLEIHDKIIAVRQLKKKKKRRVI
Download sequence
Identical sequences ENSRNOP00000040507 10116.ENSRNOP00000040507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]