SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000040974 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000040974
Domain Number 1 Region: 24-165
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.42e-42
Family Regulator of G-protein signaling, RGS 0.0000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000040974   Gene: ENSRNOG00000042592   Transcript: ENSRNOT00000043185
Sequence length 181
Comment pep:known chromosome:RGSC3.4:1:187633642:187664295:-1 gene:ENSRNOG00000042592 transcript:ENSRNOT00000043185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPEGVKRFREFLK
KEFSEENVLFWLACEDFKKTEDKKQMQEKAKKIYMTFLSNKASSQVNVEGQSRLTEKILE
EPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHRRTEEEEEDPPDAQTAAKRASRIYN
T
Download sequence
Identical sequences P49806
10116.ENSRNOP00000027375 ENSRNOP00000040974 ENSRNOP00000027375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]