SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000041289 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000041289
Domain Number 1 Region: 124-261
Classification Level Classification E-value
Superfamily C-type lectin-like 5.25e-32
Family C-type lectin domain 0.00000148
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000041289
Domain Number - Region: 70-121
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000802
Family SNARE fusion complex 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000041289   Gene: ENSRNOG00000031873   Transcript: ENSRNOT00000050062
Sequence length 265
Comment pep:known chromosome:RGSC3.4:4:167890074:167911489:-1 gene:ENSRNOG00000031873 transcript:ENSRNOT00000050062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEQRFTFSTARFHKSSVLQNQERTEETQRPRKAGNRVCWQITVTALGILCFFRLVSVAV
MVINIFQYSQEKHELQETLSNLHHNYSTMQNDINLKEEMLRDMSTEYSAVNHFLDFLNRE
KNRCYNKTKTVLDSSQHSGRGVEMHWFCYGIKCYYFIMDRKTWSGCTQTCQNFSLPLLTI
DDEDELMFLHLLVTPDSYWIGLSYDNKKSDWTWIDNNPSKLALNTRKYNIKDGGCVFLSK
TRLDNINCDNLFSCICGKRLDKFPD
Download sequence
Identical sequences Q5MPW6
10116.ENSRNOP00000041289 ENSRNOP00000041289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]