SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000042155 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000042155
Domain Number 1 Region: 679-754
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 7.85e-29
Family AN1-like Zinc finger 0.00000847
Further Details:      
 
Domain Number 2 Region: 22-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.28e-26
Family Ubiquitin-related 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000042155   Gene: ENSRNOG00000011791   Transcript: ENSRNOT00000043556
Sequence length 759
Comment pep:known chromosome:RGSC3.4:4:152404044:152455197:1 gene:ENSRNOG00000011791 transcript:ENSRNOT00000043556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKADLGTIGIQLHTTYSRRIRKVKVMDNRKEPPFFNEDNVGPFYFKLPFYDPMELFIET
LTGTCFELRVSPFEAVISVKGKIQRLEGIPICQQHLIWNNMELEDDYCLNDYNISEGCTL
KLVLAMRGGPISTRKVPVEDPLRELAEYMDSSRDEVWEKTSCNKQVTFLVYREGDQLNFF
RVVDRGDGTLTPLSESTKKLIAHMHTWHSRGRGRQNGGSVYNLYTDEDEETEPSPSGQQI
IENSITMNKMKLLKAKMENMNLSKKPKKVVKVKPRPPIAPRPSSSSAAAARHRLLRVLPH
IGQSCLPSGNAYVPETSRNAGTSSAAQAPADRPMPSLRSELLKDDGNWERNMLSHSTSSI
RLLPQLTHLDLENDKELPDSVLHLGSSLPRRTKHLSGNLSSNNEEDVVLFPRSEECVADE
LLLPEVGPFAPFAEGNGAEQSSGVEGLGKVTPEFPLTKGDGGLRAAEQPLSHMARVLSSD
PGDNAVLNHHREPGSHKNRLLSPLLCVAPVSLHNSLVKPQRQSKCFESGNPSASTSQNTL
RELDIRTIADSPFSRTARFRGVKVDSPGKRSDVISKVEARDITEMANKASKEPVGCVNNN
GFLASLARSASRDSLHSTRGVGRLRSSGIGLSTNFQHFQDENIRKSSPQSEPTDFFLSAR
GIGMNGSNAAAGKRIGESTHHLPPVKAPLQTKKKVTKHCFLCGKKTGLATSFECRCGNNF
CASHRYAEAHGCTYDYKSTGRRYLQEANPVVNAPKLPKI
Download sequence
Identical sequences 10116.ENSRNOP00000053212 ENSRNOP00000042155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]