SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000042819 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000042819
Domain Number 1 Region: 73-129
Classification Level Classification E-value
Superfamily BPTI-like 9.65e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0013
Further Details:      
 
Domain Number 2 Region: 32-71
Classification Level Classification E-value
Superfamily Elafin-like 0.0000017
Family Elafin-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000042819   Gene: ENSRNOG00000031823   Transcript: ENSRNOT00000048654
Sequence length 182
Comment pep:known chromosome:RGSC3.4:3:155634498:155641866:1 gene:ENSRNOG00000031823 transcript:ENSRNOT00000048654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHWGLLPFLVPLIFLWSIQKPQLTEGLFFKTCPKYKIKCDFEERSQCSRHKQCPEKQRC
CMFACGKKCLDLNEDICSLPQDAGPCLAYLPRWWYNKKTNLCTQFIYGGCQGNTNNFLSK
DICTSICTRKHSVHISSQPSACKITVVRQDNSVYCKLLKNRAKEEPASLNLRGSFEKYLA
LC
Download sequence
Identical sequences Q6IE19
10116.ENSRNOP00000042819 NP_001008867.1.100692 NP_001008867.1.4139 ENSRNOP00000042819 ENSRNOP00000042819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]