SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000043010 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000043010
Domain Number 1 Region: 742-870
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.17e-31
Family Synaptotagmin-like (S variant) 0.00000105
Further Details:      
 
Domain Number 2 Region: 30-161
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.8e-27
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0028
Further Details:      
 
Domain Number 3 Region: 1408-1528
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-23
Family Synaptotagmin-like (S variant) 0.0077
Further Details:      
 
Domain Number 4 Region: 554-678
Classification Level Classification E-value
Superfamily PDZ domain-like 3.19e-21
Family PDZ domain 0.00000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000043010   Gene: ENSRNOG00000004201   Transcript: ENSRNOT00000050753
Sequence length 1557
Comment pep:known chromosome:RGSC3.4:7:74757003:75271771:1 gene:ENSRNOG00000004201 transcript:ENSRNOT00000050753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPLGPRGRPAPTPAASQPPPQPEMPDLSHLTEEERKIIQAVMDRQKKEEEKEQSVLKK
LHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCG
GRVSLRSNKVMWVCNLCRKQQEILTKSGAWFYNSGSNTPQQPDQKALRGLRSEEAPQEKK
AKLHEQTQFQGPPGDSSVPAVERGRAHGLTRQDSIKNGSGMKHQIASDMPSDRKRSPSVS
RDQNRRYDQSEEREEYSQYVPSDSTMPRSPSDYADRRSQREPQFYEEPDHLNYRDSNRRG
HRHSKEYIVDDEDVESRDEYERQRREEEYQARYRSDPNLARYPVKPQPYEEQMRIHAEVS
RARHERRHSDVSLANAELEDSRISLLRMDRPSRQRSVSERRAAMENQRSYSMERTREAQG
QSSYPQRTTNHSPPTPRRSPIPLDRPELRRADSLRKQHHLDPSSAVRKTKREKMETMLRN
DSLSSDQSESVRPPPPRPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVEIESESVSE
KGDMEYSWLEHASWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAM
LGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNI
ILESKPEPQVELVVSRPIGDMPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGML
RDVPQFLSGQLSSQSLSRRTTPFVPRVQIKLWFDKVGHQLIVTILGAKDLPSREDGRPRN
PYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVR
EEESEFLGEILIELETALLDDEPHWYKLQTHDVSSLPLPHPSPYMPRRQLHGESPTRRLQ
RSKRISDSEVSDYDCEDGVGVVSDYRHDGRDLQSSTLSVPEQVMSSNHCSPSGSPHRVDV
IGRTRSWSPSVPPPQRNVEQGLRGTRATGHYNTISRMDRHRVMDDHYSSERDSHFLTLPR
SRHRQTSEHHHRDGRDCEAADRQPYHRSRSTEQRPLLERTTTRSRSSERADTNLMRSMPS
LMTGRSAPPSPALSRSHPRTGSVQTSPSSTPVTGRRGRQLPQLPPKGTLERMITEDMDST
RKRNSGAMDIEERNRQMKLNKYKQVAGSDPRLEQDYHSKLKYRSGWDPHRGADTVSTKSS
DSDVSDVSAVSRTSSASRFSSTSYMSVQSERPRGNRKISVFTSKMQSRQMGVSGKSMAKS
TSISGDMCSLEKNDGSQSDTAVGALGTSGKKRRSSIGAKMVAIVGLSRKSRSASQLSQTE
GGGKKLRSTVQRSTETGLAVEMRNWMTRQASRESTDGSMNSYSSEGNLIFPGVRLASDSQ
FSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAP
YVKVYLLDNGVCIAKKKTKVARKTLEPLYQQLLSFEESPQGKVLQIIVWGDYGRMDHKSF
MGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSLESSTGPSYSRS
Download sequence
Identical sequences 10116.ENSRNOP00000045165 ENSRNOP00000043010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]