SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000043105 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000043105
Domain Number 1 Region: 84-141
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000196
Family AN1-like Zinc finger 0.0017
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000012
Family AN1-like Zinc finger 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000043105   Gene: ENSRNOG00000032917   Transcript: ENSRNOT00000047634
Sequence length 171
Comment pep:known chromosome:RGSC3.4:12:15661609:15672672:1 gene:ENSRNOG00000032917 transcript:ENSRNOT00000047634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPDLGKHCSEPTCKQLDFLPITCDACKQDFCKDHFSYSGHKCPFAFKKDVQVPVCPLC
NAPIPVRRGDIPDVVVGEHMDRDCTFHPGRNRNKVFTHRCSKEGCRKKEMLQLACAQCHG
NFCIQHRHPLDHNCQAGSSSVSRGRSSASRAAEQKPSGVSWLAQRLRRTVK
Download sequence
Identical sequences Q5U2P3
NP_001008364.1.100692 NP_001008364.1.4139 ENSRNOP00000043105 ENSRNOP00000043105 10116.ENSRNOP00000043105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]