SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000043456 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000043456
Domain Number 1 Region: 15-95
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.09e-32
Family PB1 domain 0.00000793
Further Details:      
 
Domain Number 2 Region: 127-249
Classification Level Classification E-value
Superfamily PDZ domain-like 1.2e-22
Family PDZ domain 0.00000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000043456   Gene: ENSRNOG00000017746   Transcript: ENSRNOT00000044971
Sequence length 345
Comment pep:known chromosome:RGSC3.4:19:35533934:35535711:1 gene:ENSRNOG00000017746 transcript:ENSRNOT00000044971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRTSVRGFQEFSRLLCVVHQIPGLDVLLG
YTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKREGDSSGLAFASNSLQRRKKGLLLRP
VAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVRV
APQGLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSHN
LIVTVKPANQRNNVVRGASGRLTGPSSVGPGPTDPDSDDDNSDPVIENRHPPCSNGLSQG
PLCWDLQPGCLLPSAGSSLPSLDSREQANSGWGNGMRGDVSGFSL
Download sequence
Identical sequences A0A0G2JUC3
ENSRNOP00000043456 10116.ENSRNOP00000043456 NP_001003653.2.100692 NP_001003653.2.4139 ENSRNOP00000043456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]