SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000043788 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000043788
Domain Number 1 Region: 533-941,985-1008
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.19e-97
Family Glycine dehydrogenase subunits (GDC-P) 0.000000192
Further Details:      
 
Domain Number 2 Region: 70-489
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.91e-97
Family Glycine dehydrogenase subunits (GDC-P) 0.00000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000043788   Gene: ENSRNOG00000011599   Transcript: ENSRNOT00000048732
Sequence length 1024
Comment pep:known chromosome:RGSC3.4:1:233846690:233925528:-1 gene:ENSRNOG00000011599 transcript:ENSRNOT00000048732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLCARAWGLRLGPGAGGGHRLARGTGLSWAPRSRDSSSGGGGGGGDRGAAGASRLLERL
LPRHDDFARRHIGPGDKDRREMLQALGLASIDELIEKTVPASIRLKRPLKLEDPVCENEI
LETLHAIASKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWVTQYTPYQPEVSQGRLESL
LNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHRHNKRKRFFIDPRCHPQTIAVVQTR
AKYRGVIVELKLPHEMDFSGKDVSGVLFQYPDTEGKVEDFTELVERAHQTGSLTCCATDL
LALCILRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVRESLVRMMPGRMVGVTRDAT
GKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSHGLQHIAKRVHNATL
ILSEGLKRAGHQLQHDLFFDTLKVQCGCSLKEVLGRAAQRQINFRLFDDGTLGISLDETV
TEKDLDDLLWIFGCESSTELVAEGMGEEWRGLLGSSFKRTSPFLTHQVFNSYHSETNLVR
YMKKLENKDISLVHSMIPLGSCTMKLNSSSELTPITWREFANIHPFVPLDQAQGYQQLFQ
ELEKDLCELTGYDRVSFQPNSGAQGEYAGLATIRAYLDQKGERHRTVCLIPKSAHGTNPA
SAYMAGMKIQPVEVDRYGNIDVAHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCAL
IHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHL
VPFLPSHPIVCLKPNEDTWPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKEATEIAILN
ANYMAKRLERYYRVLFRGARGYVAHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMS
WPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVT
SSRWDRPYSREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQK
RASS
Download sequence
Identical sequences ENSRNOP00000043788 10116.ENSRNOP00000015456 XP_006231272.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]