SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000043981 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000043981
Domain Number 1 Region: 34-90
Classification Level Classification E-value
Superfamily BPTI-like 1.5e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0029
Further Details:      
 
Domain Number 2 Region: 126-185
Classification Level Classification E-value
Superfamily BPTI-like 7.9e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000043981   Gene: ENSRNOG00000020636   Transcript: ENSRNOT00000046611
Sequence length 250
Comment pep:known chromosome:RGSC3.4:1:84393849:84416299:-1 gene:ENSRNOG00000020636 transcript:ENSRNOT00000046611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLCEPRRGRALLALLASLLLSGAQAASRDLDVHESCGVSKVVGKCRASIPRWWYNVTD
GTCQPFVYGGCEGNGNNYPSKEECLDKCAGITENTIDGLARSSDGASALSVPRKQDSADL
AGEIFNYEEYCVPKAVTGPCRAAFPRWYYDVEKNSCSSFIYGGCRGNKNSYLSQEACMQH
CSGKQMYPFLTPGTKAVILVGLFIMVLILLLGSSMVFLIRMVRRKQERALRTVWSTADDK
EQLVKNTCVL
Download sequence
Identical sequences G3V8S0
ENSRNOP00000043981 ENSRNOP00000028006 10116.ENSRNOP00000028006 NP_001076018.1.100692 NP_001076018.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]