SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000044001 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000044001
Domain Number 1 Region: 1238-1399
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-76
Family Pleckstrin-homology domain (PH domain) 0.0000000307
Further Details:      
 
Domain Number 2 Region: 1034-1241
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.24e-51
Family DBL homology domain (DH-domain) 0.00000000596
Further Details:      
 
Domain Number 3 Region: 432-547
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-19
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 
Domain Number 4 Region: 840-915
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000306
Family PDZ domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000044001
Domain Number - Region: 768-805
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0672
Family Ras-binding domain, RBD 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000044001   Gene: ENSRNOG00000021569   Transcript: ENSRNOT00000046486
Sequence length 1589
Comment pep:known chromosome:RGSC3.4:11:30133637:30250856:1 gene:ENSRNOG00000021569 transcript:ENSRNOT00000046486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAESQNVDHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKAIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQEGALDDFGDPIWVDRVDMGLRPVSYTDSSVTPSVDGSIVLTA
ASVQSMPDSEESRLYGDDAAYLAEGGRRQRPYTSNGPTFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGMETGASPRQLSTCQRANSLGDLYAQKN
SGVKANGGPRNRFSSYCRNLVSDIPDLAKHKMPPAAVETPTYSNYNTLPCRKSHCLSEGA
TNPQISLSKSMQGRRAKTTQDVNTGEGRSADSGIEGATTDTDLLSRRSNATNSSYSPPTG
RAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSPGQ
SDILLTAAQGTVRKAGALAVKNFLHKKNKKVESATRRKWKHYWVSLKGCTLFFYESDGRS
GIDHNSVPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWITAIH
SACAAAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDAKKKKTILDQ
IFVWEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLGFASRPTKVAMGRLGIFSVSSFH
ALFAALTGQCGEKINRQAQERSLAQRKFRRSPLYSLKTEERKRQSGPVFNKQVFGEGTDA
VKRSLEGIFDDSVPDGKREKEVVLPSVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTVVR
PGDTARDTLELICKAHQLDHSAHYLRLKFLMENKMQFYVPQPEEDIYELLYKEIEICPKV
TQNIHIEKSDAAADNYGFLLSSVDEDGVRRLYVNSVKETGLASKKGLKAGDEILQINNRA
AGTLNSSMLKDFLSQPSLGLLVRTYPEPEGGVELLENPPHRVDGPVDLGESPLTFLTSNP
GHSLSSEQGSSAETAPEEGEGPDLESSDETDHSSKSTEQVTAFCRSLHEMSPSDSSPSPQ
DATSPQLATTRQLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDELD
VLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFKLY
SAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPRQQHSSTLESYLIKPIQRVLKYPLLLRE
LFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVADL
SMGDLLLHTSVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRLSI
YEEWDPFRFRHMIPTEALQVRALPSADAEANAVCEIVHVKSESEGRPERVFHLCCSSPES
RKDFLKSVHSILRDKHRRQLLKTESLPSAQQYVPFGGKRLCALKGARPAMSRAVSAPSKS
LGRRRRRLARNRFTIDSDAISASSPEKEPQQPPGGGDTDRWVEEQFDLAQYEEQDDIKET
DILSDDDEFCESAKGASVDIDLQEQLQAASISQRARGRKTLDSHASRMTQLKKQAALSGI
NGGLESASEEVIWVRREDFAPSRKLNTEI
Download sequence
Identical sequences 10116.ENSRNOP00000044001 ENSRNOP00000044001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]