SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000044458 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000044458
Domain Number 1 Region: 5-96
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-27
Family PDZ domain 0.00018
Further Details:      
 
Domain Number 2 Region: 143-232
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-26
Family PDZ domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000044458   Gene: ENSRNOG00000002997   Transcript: ENSRNOT00000043592
Sequence length 337
Comment pep:known chromosome:RGSC3.4:10:13890293:13900807:-1 gene:ENSRNOG00000002997 transcript:ENSRNOT00000043592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPESLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVN
GVNVEGETHHQVVQRIKAVEGQTQLLVVDKETDEELCRRQLTCTEEMAHRGLPPAHNPWE
PKPDWACSGSLGSDTGQKDVNGPPRELRPRLCHLRRGPQGYGFNLHSDKSRPGQYIRSVD
PGSPASLSGLRAQDRLIEVNGQNVEGLRHAEVVARIKAQEDEARLLVVDPETDEHFKRLR
VVPTEDHVEGPLPSPVTNGTSLAQLNGGSVCSSRSDLPGSEKDNEDGSAWKRDPFQESGL
HLSPTAAEAKEKARATRVNKRAPQMDWNRKREIFSNF
Download sequence
Identical sequences G3V6D9
10116.ENSRNOP00000004172 NP_446263.2.100692 NP_446263.2.4139 ENSRNOP00000004172 ENSRNOP00000044458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]