SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000044856 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000044856
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.79e-31
Family Ubiquitin-related 0.00000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000044856   Gene: ENSRNOG00000032840   Transcript: ENSRNOT00000049609
Sequence length 95
Comment pep:known chromosome:RGSC3.4:5:15325451:15326430:1 gene:ENSRNOG00000032840 transcript:ENSRNOT00000049609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEKPKEGVKTENNDHINLKAVGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF
EFDGQPINETDTPAQLEMEDEDTIDVFRQQTGGVY
Download sequence
Identical sequences F1LN30
ENSRNOP00000044856 ENSRNOP00000044856 XP_002729504.1.100692 XP_003754032.1.4139 10116.ENSRNOP00000044856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]