SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000045330 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000045330
Domain Number 1 Region: 80-181
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-25
Family PDZ domain 0.0034
Further Details:      
 
Domain Number 2 Region: 202-307
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-23
Family PDZ domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000045330   Gene: ENSRNOG00000032946   Transcript: ENSRNOT00000043623
Sequence length 532
Comment pep:known chromosome:RGSC3.4:1:250101703:250111651:-1 gene:ENSRNOG00000032946 transcript:ENSRNOT00000043623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGFTVGFDPLGLGELSSASLSSLSSRGHLGSDSASTATRYLLRKQQRLLNGPSRGIRA
SSPMGRVILINSPIEANSDESDIIHAVCVEKSPSGRLGFSVRGGSEHGLGIFVSKVEEGS
SAERAGLCVGDKITEVNGLSLESTTMGSAVRLLTSSSRLHMMVRRMGRVPGIKFSKEKTT
WVDVVNRRLVVEKCSSTPSDSSSEDGVRRIVHLYTTSDDFCLGFNIRGGKEFGLGIYVSK
VDHGGLAEENGIKVGDQVLAANGVRFDDISHSQAVEVLKGQTHIMLTIKETGRYPAYKEM
VSEYCWLDRLSNGVLQQLSPASESSSSVSSYASSAPCSSGSLPSDRMDVCLGPEDPTSQG
PGWGRADTAMQTEPDMGGSRVETWCSVRPTVILRDTAIRSDGPSSTRHLDSALSESPKTA
LLLALSRPRPPITRSQSHLTLWDPVPSWGLPRIYRGEETAEEGEVRILWGEGGLAALQDA
DEPLLQGRAAGATSRGRAQRGLDTGQQKPHQSPSSPGPGETWSHVLSAAVAV
Download sequence
Identical sequences 10116.ENSRNOP00000049968 ENSRNOP00000045330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]