SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000046298 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000046298
Domain Number 1 Region: 754-984
Classification Level Classification E-value
Superfamily vWA-like 3.71e-47
Family Integrin A (or I) domain 0.00062
Further Details:      
 
Domain Number 2 Region: 46-226
Classification Level Classification E-value
Superfamily vWA-like 7.86e-30
Family Integrin A (or I) domain 0.0023
Further Details:      
 
Domain Number 3 Region: 1083-1140
Classification Level Classification E-value
Superfamily BPTI-like 4.26e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000046298   Gene: ENSRNOG00000033618   Transcript: ENSRNOT00000045270
Sequence length 1142
Comment pep:known chromosome:RGSC3.4:4:33043709:33216862:-1 gene:ENSRNOG00000033618 transcript:ENSRNOT00000045270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKRDVAFCLLLLPAFMTQAVYGQRKKGPKPNILARKNDFQXPFATIDVVFILDSSESSK
IVLFDNQKDFVDSLSEKLFQLTPGHSLRYDIKLAALQFSSSVQIDPPFSSWKDLRTFKQR
VKSLNLIGQGTFSYYAISNATRLLKKEGRKDGVKVALLMTDGIDHPKSPDVQSISEDARI
SGISFITVGLSTVVNEAKLRLISGDSSNEPVLLLSDPTLVDKIRGRLDVLFERKCEHKIC
ECEKGDPGDPGPPGTHGNPGIKGERGPKGNPGDAQKGETGERGPVGIPGYKGDKGERGEC
GKPGMKGDKGPAGPYGPKGPRGIQQGIGGPPGDPGPKGFQGNKGEPGPPGPYGPPGAPGI
GQQGVKGERGQEGRTGAPGPIGIGEPGQPGPRGPEGAPGERGLPGEGVPGPKGEKGSEGP
TGPQGLQGLSIKGDKGILGPVGPPGPAGILALSQGEQGIQGPTGPPGPQGPPGQGSPGPK
GEVGRMGPTGPRGPMGIGIQGPKGEPGTVGLPGQPGVPGEDGASGKKGEAGLPGTRGPEG
MPGKGQPGPKGDEGKKGSKGNQGQRGFPGPEGPKGEPGIMGPFGMPGASIPGPSGPKGDR
GGPGMPGLKGEPGLSVRGPKGAQGPRGPVGAPGLKGDGYPGVASPSGLPFPPGNKGLLIP
GKLGKQGEPGVRGPPGPSGPRGIGIQGPKGDTGQKGLPGPPGPPGYGSQGIKSEEGPQTF
PFSKESLGLAMPGEKGEHGERGDVGRKGEKGDIGEPGSPGKQGLQGPKGDLGLTKEEIIK
LIIEICGCGPKCKETPLELVFVIDSSESVGPENFQIIQNFVKTLADRVALDLGTARIGII
NYSHKVEKVASLKQFSSKDDFKLVVDNMQYLGEGTYTATALQAANDMFKEARPGVKKVAL
VITDGQTDSRDKRKLADVVKDANDSKVEIFVIGVVKKDDPNFEIFHKEMNLIATDSEHVY
QFDDFFTLQEDTLKQKLSKKICEDFDSYLIQVFGSSSFQPEFGVSEREVNISTPKPTKEI
SKLFNISRGQNEETEPSVLTEAGNLAIPTPPEATNTLKPLLSSPERVEARTPNPNLLQSE
KSLYKDPRCEEALKPGNCGDYVVRWYYDKQVNSCARFWFSGCNGSGNRFHSEKECQETCI
KQ
Download sequence
Identical sequences ENSRNOP00000046298 10116.ENSRNOP00000046298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]