SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000046367 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000046367
Domain Number - Region: 94-180
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00497
Family Myosin rod fragments 0.017
Further Details:      
 
Domain Number - Region: 16-108
Classification Level Classification E-value
Superfamily Typo IV secretion system protein TraC 0.0471
Family Typo IV secretion system protein TraC 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000046367   Gene: ENSRNOG00000040009   Transcript: ENSRNOT00000045649
Sequence length 194
Comment pep:known chromosome:RGSC3.4:15:5494404:5499625:-1 gene:ENSRNOG00000040009 transcript:ENSRNOT00000045649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHQLLKLVQKEGGDQGETRRRQKKAGLLSWFIRKASSENFISNHEKRIKNLEELKLEIQ
KCKSERDELSQILDLYVNDGLNYRLSVELPMLKSQHEMRTMDMHKMTNWISDAMEKYQEL
MQENNSYRIRNFHLLNECNELKKNVRILMNENRKLLVEQTELQASCEEGKRFCEEASKTI
YTADIESLCPVTFE
Download sequence
Identical sequences ENSRNOP00000046367 10116.ENSRNOP00000046367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]