SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000046514 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000046514
Domain Number 1 Region: 438-550
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-26
Family PDZ domain 0.0024
Further Details:      
 
Domain Number 2 Region: 265-360
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000421
Family PDZ domain 0.013
Further Details:      
 
Domain Number 3 Region: 573-633
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000593
Family PDZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000046514   Gene: ENSRNOG00000032437   Transcript: ENSRNOT00000050595
Sequence length 1333
Comment pep:known chromosome:RGSC3.4:19:57248705:57603133:1 gene:ENSRNOG00000032437 transcript:ENSRNOT00000050595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVTVCFGRTRVVVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGDGGILD
LDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFRPYQ
TTSEIEVTPSVLRANMPLHVRRSSDPALTGLSTSVSDNNFSSEEPSRKNPTRWSTTAGFL
KQNTTGSPKTCDRKKDENYRSLPRDPSSWSNQFQRDNARSSLSASHPMVDRWLEKQEQDE
EGTEEDSSRVEPVGHADTGLENMPNFSLDDMVKLVQVPNDGGPLGIHVVPFSARGGRTLG
LLVKRLEKGGKAEQENLFHENDCIVRINDGDLRNRRFEQAQHMFRQAMRARVIWFHVVPA
ANKEQYEQLSQREMNNYSPGRFSPDSHCVANRSVANNAPQALPRAPRLSQPPEQLDAHPR
LPHSAHASTKPPTAPALAPPNVLSTSVGSVYNTKRVGKRLNIQLKKGTEGLGFSITSRDV
TIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAGKSQEEVVSLLRSTKMEGTV
SLLVFRQEEAFHPREMNAEPSQMQSPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAG
LGVSVKGKRSKEXHADLGIFVKSIINGGAASKDVLFRVPLSCKPGDHLTYSASQKAGETT
GEALSQKQNKTIMIKLEELKGVLNSLRSPGSPAAPELPIETELDDRERRISHSLYSGIEG
LDESPTRNAALSRIMGESGKCQLSPTVNMPHDDTVMIEDDRLPVLPPHLSDQSSSSSHDD
VGFIMTEAGTWAKATISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSNASQLDF
VKTRKSKSMDLGIADETKLNTVDDQRAGSPNRDVGPSLGLKKSSSLESLQTAVAEVTLNG
NIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPMVDDDDEGMETLEEDTEESSRSGRESVS
TSSDQPSYSLERQMNGDPEKRDKAEKKKDKAGKDKKKDREKEKDKLKAKKGMLKGLGDMF
RFGKHRKDDKMEKMGRIKIQDSFTSEEDRVRMKEEQERIQAKTREFRERQARERDYAEIQ
DFHRTFGCDDELLYGGMSSYDGCLALNARPQSPREGHLMDTLYAQVKKPRSSKPGDSNRS
TPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQSWSSSRPASQSGRHSVSVEVQVQRQ
RQEERESFQQAQRQYSSLPRQSRKNASSVSQDSWEQNYAPGEGFQSAKENPRYSSYQGSR
NGYLGGHGFNARVMLETQELLRQEQRRKEQQLKKQPPADGVRGPFRQDVPPSPSQVARLN
RLQTPEKGRPFYS
Download sequence
Identical sequences 10116.ENSRNOP00000050169 ENSRNOP00000046514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]