SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000046786 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000046786
Domain Number 1 Region: 166-386
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.66e-48
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 1771-1837
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-19
Family SAM (sterile alpha motif) domain 0.00028
Further Details:      
 
Domain Number 3 Region: 624-720
Classification Level Classification E-value
Superfamily PDZ domain-like 3.06e-19
Family PDZ domain 0.0000294
Further Details:      
 
Domain Number 4 Region: 513-590
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-18
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000046786   Gene: ENSRNOG00000029931   Transcript: ENSRNOT00000045145
Sequence length 1839
Comment pep:known chromosome:RGSC3.4:1:204586363:204855453:1 gene:ENSRNOG00000029931 transcript:ENSRNOT00000045145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSPTSSEDEMAQSFSDYSVGSESDSSKEETIYDTIRATTEKPGGVKMEDLQGNTLVIR
VVIQDLQQTKCIRFNPDATVWVAKQRILCTLNQGLKDVLNYGLFQPASNGRDGKFLDEER
LLREYPQPMGQGVPSLEFRYKKRVYKQSNLDEKQLARLHTKTNLKKFMDHTQHRSVEKLV
KLLDRGLDPNFHDLETGETPLTLAAQLDGSMEVIKALRNGGAHLDFRSRDGMTALHKAAR
MRNQVALKTLLELGASPDYKDSYGLTPLYHTAIVGGDPYCCELLLHEHASVCCKDENGWH
EIHQACRYGHVQHLEHLLFYGADMSAQNASGNTALHICALYNQDSCARVLLFRGGDKELK
NYNSQTPFQLAVLAAVFELAELFKTHTQTHPVPFREAPAYSNRRRRPPNTLAAPRVLLRS
NSDNNLNAGAPEWAVCSAATSHRSLSPQLLQQTPSKPDGATKSLGSYAPGPRSRSPSLNR
LGGAGEDGKRPQPPHWHVGSPFTPGANKDSLSTFEYPGPRRKLYSAVPGRLFVAIKPYQP
QVDGEIPLHRGDRVKVLSIGEGGFWEGSARGHIGWFPAECVEEVQCKPRDSQAETRADRS
KKLFRHYTVGSYDSFDAASDCIIEDKTVVLQKKDNEGFGFVLRGAKADTPIEEFTPTPAF
PALQYLESVDEGGVAWQAGLRTGDFLIEVNNENVVKVGHRQVVNMIRQGGNHLVLKVVTV
TRNLDPDDTARKKAPPPPKRAPTTALTLRSKSMTAELEELDKPEEIVPASKPSRTAENVA
IESRVATIKQRPTSRCFPAASDVNSVYERQGIAVMTPTVPGSPKGPFLGLPRGTMRRQKS
IDSRIFLSGITEEERQFLAPPMLKFTRSLSMPDTSEDIPPPPQSVPPSPPPPSPTTYNCP
RSPTPRVYGTIKPAFNQNPVAKVPPATRSDTVATMMREKGMFYRRELDRFSLDSEDVYSR
SPAPQAAFRTKRGQMPENPYSEVGKIASKAVYVPAKPARRKGMLVKQSNVEDSPEKTCSI
PIPTIIVKEPSTSSSGKSSQGSSMEIDPQATEPGQLRPDDSLTVSSPFAAAIAGAVRDRE
KRLEARRNSPAFLSTDLGDEDVGLGPPAPRMQPSKFPEEGGFGDEDETEQPLLPTPGAAP
RELENHFLGGGEAGAQGEAGGPLSSTSKAKGPESGPAAALKSSSPASPENYVHPLTGRLL
DPSSPLALALSARDRAMQESQQGHKGEAPKADLNKPLYIDTKMRPSVESGFPPVTRQNTR
GPLRRQETENKYETDLSKDRRADDKKNMLINIVDTAQQKSAGLLMVHTVDIPVAGPPLEE
EEDREDGDTKPDHSPSTVPEGVPKTEGALQISAAPEPAAAPGRTIVAAGSVEEAVILPFR
IPPPPLASVDLDEDFLFTEPLPPPLEFANSFDIPDDRAASVPALADLVKQKKSDTPQPPS
LNSSQPANSTDSKKPAGISNCLPSSFLPPPESFDAVTDSGIEEVDSRSSSDHHLETTSTI
STVSSISTLSSEGGESMDTCTVYADGQAFVVDKPPVPPKPKMKPIVHKSNALYQDTLPEE
DTDGFVIPPPAPPPPPGSAQAGVAKVIQPRTSKLWGDVTEVKSPILSGPKANVISELNSI
LQQMNRGKSVKPGEGLELPVGAKSANLAPRSPEVMSTVSGTRSTTVTFTVRPGTSQPITL
QSRPPDYESRTSGPRRAPSPVVSPTELSKEILPTPPSAAAASPSPTLSDVFSLPSQSPAG
DLFGLNPAGRSRSPSPSILQQPISNKPFTTKPVHLWTKPDVADWLESLNLGEHKETFMDN
EIDGSHLPNLQKEDLIDLGVTRVGHRMNIERALKQLLDR
Download sequence
Identical sequences 10116.ENSRNOP00000045017 ENSRNOP00000046786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]