SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000047110 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000047110
Domain Number 1 Region: 7-144
Classification Level Classification E-value
Superfamily UBC-like 2.2e-39
Family UBC-related 0.000000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000047110   Gene: ENSRNOG00000001829   Transcript: ENSRNOT00000044803
Sequence length 145
Comment pep:known chromosome:RGSC3.4:11:87228040:87247667:1 gene:ENSRNOG00000001829 transcript:ENSRNOT00000044803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVYIGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYEN
RIYSLKVECGSKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQ
ELRRLMMSKENMKLPQPPEGQTYNN
Download sequence
Identical sequences A0A0G2JU07
ENSRNOP00000047110 10116.ENSRNOP00000039863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]