SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000047115 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000047115
Domain Number 1 Region: 576-765
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.29e-55
Family Nucleotide and nucleoside kinases 0.00000000796
Further Details:      
 
Domain Number 2 Region: 347-444
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-32
Family PDZ domain 0.000017
Further Details:      
 
Domain Number 3 Region: 448-604
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-32
Family SH3-domain 0.0000036
Further Details:      
 
Domain Number 4 Region: 98-197
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-28
Family PDZ domain 0.0000223
Further Details:      
 
Domain Number 5 Region: 200-295
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-26
Family PDZ domain 0.0000183
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000047115
Domain Number - Region: 25-51
Classification Level Classification E-value
Superfamily L27 domain 0.00118
Family L27 domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000047115   Gene: ENSRNOG00000018526   Transcript: ENSRNOT00000039956
Sequence length 768
Comment pep:known chromosome:RGSC3.4:10:56875661:56890623:1 gene:ENSRNOG00000018526 transcript:ENSRNOT00000039956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEACILESQKYRYQDE
GQPGLQKSPAHSLLSQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLG
FSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEA
LKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIE
GGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYA
PPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVI
HRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAA
IALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRAL
FDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVER
REWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFP
DKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSV
REVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDR
ATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL
Download sequence
Identical sequences ENSRNOP00000047115 10116.ENSRNOP00000025211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]